| 544 |
SELECT SQL_NO_CACHE o.id_order
FROM ps_orders o
LEFT JOIN ps_order_detail od ON (od.id_order = o.id_order)
WHERE o.valid = 1
AND od.product_id IN (1536) |
5.878
ms
|
29 |
|
|
/modules/iqitcrossselling/iqitcrossselling.php:264
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 2 |
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `ps_configuration` c
LEFT JOIN `ps_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`) |
5.544
ms
|
7446 |
|
|
/classes/Configuration.php:180
/classes/Configuration.php:229 (loadConfiguration)
/classes/Configuration.php:302 (get)
/classes/shop/Shop.php:398 (getMultiShopValues)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 545 |
SELECT SQL_NO_CACHE DISTINCT od.product_id
FROM ps_order_detail od
LEFT JOIN ps_product p ON (p.id_product = od.product_id)
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)LEFT JOIN `ps_product_attribute` pa ON (p.`id_product` = pa.`id_product`)
LEFT JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.`default_on` = 1)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
LEFT JOIN ps_product_lang pl ON (pl.id_product = od.product_id AND pl.id_shop = 1 )
LEFT JOIN ps_category_lang cl ON (cl.id_category = product_shop.id_category_default AND cl.id_shop = 1 )
LEFT JOIN ps_image i ON (i.id_product = od.product_id)
LEFT JOIN `ps_category_product` cp ON (cp.`id_category` = product_shop.id_category_default AND cp.id_product = product_shop.id_product)
LEFT JOIN `ps_category_group` cg ON (cp.`id_category` = cg.`id_category`)
WHERE od.id_order IN (7672,9077,9272,9407,9551,9749,10692,11550,11606,11857,12274,12727,13320,13374,13693,13892,14340,14793,14972,15292,15999,7583,9030,9070,9104,11440,12856,14811)
AND pl.id_lang = 5
AND cl.id_lang = 5
AND od.product_id NOT IN (1536)
AND i.cover = 1
AND stock.quantity > 0
AND p.visibility IN ("both", "catalog")
AND product_shop.active = 1
AND cg.`id_group` =1
ORDER BY RAND()
LIMIT 4 |
5.417
ms
|
65 |
Yes
|
|
/modules/iqitcrossselling/iqitcrossselling.php:325
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 99 |
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`, pl.`description_short`, pl.`link_rewrite`,
pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, pl.`available_now`, pl.`available_later`,
image_shop.`id_image` id_image, il.`legend`, m.`name` as manufacturer_name, cl.`name` AS category_default, IFNULL(product_attribute_shop.id_product_attribute, 0) id_product_attribute,
DATEDIFF(
p.`date_add`,
DATE_SUB(
"2025-10-28 00:00:00",
INTERVAL 200 DAY
)
) > 0 AS new
FROM `ps_accessory`
LEFT JOIN `ps_product` p ON p.`id_product` = `id_product_2`
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN `ps_product_lang` pl ON (
p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 5 AND pl.id_shop = 1
)
LEFT JOIN `ps_category_lang` cl ON (
product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 5 AND cl.id_shop = 1
)
LEFT JOIN `ps_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `ps_image_lang` il ON (image_shop.`id_image` = il.`id_image` AND il.`id_lang` = 5)
LEFT JOIN `ps_manufacturer` m ON (p.`id_manufacturer`= m.`id_manufacturer`)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
WHERE `id_product_1` = 1536 AND product_shop.`active` = 1 AND product_shop.`visibility` != 'none'
GROUP BY product_shop.id_product |
5.227
ms
|
13 |
|
Yes
|
/classes/Product.php:4702
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 59 |
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `ps_hook_module` hm
STRAIGHT_JOIN `ps_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `ps_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position |
3.086
ms
|
1000 |
|
|
/classes/Hook.php:456
/classes/Hook.php:493 (getHookModuleList)
/classes/tax/TaxManagerFactory.php:67 (getModulesFromHook)
/classes/tax/TaxManagerFactory.php:46 (execHookTaxManagerFactory)
/classes/Product.php:6898 (getManager)
/classes/Product.php:741 (getTaxesRate)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 58 |
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `ps_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `ps_hook_alias` ha
INNER JOIN `ps_hook` h ON ha.name = h.name |
2.052
ms
|
0 |
|
|
/classes/Hook.php:1326
/classes/Hook.php:225 (getAllHookIds)
/classes/tax/TaxManagerFactory.php:67 (getIdByName)
/classes/tax/TaxManagerFactory.php:46 (execHookTaxManagerFactory)
/classes/Product.php:6898 (getManager)
/classes/Product.php:741 (getTaxesRate)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 581 |
INSERT INTO `ps_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('1364175', '', 'www.labelbike.it/fr/autocollants-de-protection-de-reservoir-gsx-s/1536-1946-sticker-3d-tank-guard-compatible-avec-suzuki-gsx-s-1000-2021-2023.html', '', '2025-10-28 14:22:18') |
1.455
ms
|
1 |
|
|
/classes/ObjectModel.php:622
/classes/ConnectionsSource.php:105 (add)
/modules/statsdata/statsdata.php:119 (logHttpReferer)
/modules/statsdata/statsdata.php:74 (getScriptCustomerPagesViews)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 18 |
SELECT SQL_NO_CACHE lower(name) as name
FROM `ps_hook` h
WHERE (h.active = 1) |
1.310
ms
|
1153 |
|
|
/classes/Hook.php:1366
/classes/Hook.php:811 (getHookStatusByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 19 |
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `ps_module` m
INNER JOIN ps_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `ps_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `ps_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `ps_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position` |
1.272
ms
|
1309 |
Yes
|
Yes
|
/classes/Hook.php:1267
/classes/Hook.php:735 (getAllHookRegistrations)
/classes/Hook.php:842 (getHookModuleExecList)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 317 |
SELECT SQL_NO_CACHE *
FROM ps_iqitadditionaltab t
LEFT JOIN ps_iqitadditionaltab_lang tl ON (t.id_iqitadditionaltab = tl.id_iqitadditionaltab AND tl.id_lang = 5)
INNER JOIN ps_iqitadditionaltab_shop iqitadditionaltab_shop
ON (iqitadditionaltab_shop.id_iqitadditionaltab = t.id_iqitadditionaltab AND iqitadditionaltab_shop.id_shop = 1)
WHERE (t.id_product = 0 OR t.id_product = 1536) AND t.`active` = 1 GROUP BY t.id_iqitadditionaltab
ORDER BY t.`position` |
1.264
ms
|
5 |
Yes
|
Yes
|
/modules/iqitadditionaltabs/src/IqitAdditionalTab.php:118
/modules/iqitadditionaltabs/iqitadditionaltabs.php:576 (getTabs)
/modules/iqitadditionaltabs/iqitadditionaltabs.php:548 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 459 |
SELECT SQL_NO_CACHE * FROM (SELECT c.id_carrier, c.id_reference, c.name, cl.delay, c.position, c.is_free, c.range_behavior, c.shipping_method, edc.picking_limit, edc.picking_days, edc.shippingdays, edc.min, edc.max, edc.ignore_picking, edc.ed_active, edc.ed_alias, cl.delay AS carrier_description
FROM `ps_carrier` c
LEFT JOIN `ps_carrier_lang` cl ON (c.`id_carrier` = cl.`id_carrier` AND cl.`id_lang` = 5 AND cl.id_shop = 1 )
LEFT JOIN `ps_ed_carriers` AS edc ON (c.id_reference = edc.id_reference AND edc.id_shop = 1)
WHERE cl.id_lang = 5 AND active = 1 AND deleted = 0 AND cl.id_shop IN (1)
ORDER BY c.id_reference DESC, c.id_carrier DESC) AS tmp
GROUP BY id_reference |
1.260
ms
|
19 |
Yes
|
Yes
|
/modules/estimateddelivery/estimateddelivery.php:2001
/modules/estimateddelivery/estimateddelivery.php:4374 (getCarriersList)
/modules/estimateddelivery/estimateddelivery.php:4259 (getProductCarriers)
/modules/estimateddelivery/estimateddelivery.php:3492 (getAvailableCarriersForED)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 541 |
SELECT SQL_NO_CACHE cp.id_product FROM `ps_category_product` cp WHERE cp.id_category IN (315,30,336,699,700,701,702,692,703,693,704,694,705,695,706,696,707,697,698,12,49,39,50,40,41,42,32,43,33,44,34,45,35,46,36,325,47,37,48,38,310,709,342,387,666,663,664,665,343,484,754,356,710,485,755,711,486,488,489,490,491,492,481,493,719,482,494,483,495,344,900,346,498,499,500,501,502,503,504,505,506,780,782,347,508,509,510,756,511,512,513,514,515,507,349,516,517,518,519,520,521,522,337,408,810,409,363,410,744,411,412,402,413,403,414,404,738,415,405,416,406,407,350,776,688,777,689,690,712,691,774,686,687,338,433,419,430,420,431,421,432,422,423,434,424,435,425,426,427,353,417,428,354,418,429,351,523,524,525,526,527,720,339,440,451,441,452,442,453,364,443,454,444,455,445,456,446,457,436,447,458,437,448,438,449,439,450,762,853,340,388,389,390,391,392,783,394,784,785,708,341,472,800,462,474,463,733,475,464,476,465,477,466,478,467,479,772,468,480,469,797,459,667,668,470,460,471,461,355,382,378) AND cp.id_product IN (1536,0) |
1.137
ms
|
462 |
|
|
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:1453
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:1599 (listProductsBloquedCateg)
/modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php:737 (createList)
/classes/Hook.php:1077 (hookdisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 28 |
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `ps_meta` m
LEFT JOIN `ps_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC |
0.967
ms
|
162 |
Yes
|
|
/classes/Dispatcher.php:654
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 378 |
SELECT SQL_NO_CACHE * FROM ps_carrier_shop AS cs
LEFT JOIN ps_carrier USING (id_carrier)
LEFT JOIN ps_ed_carriers edc USING (id_reference, id_shop)
LEFT JOIN ps_carrier_lang AS cl USING (id_carrier, id_shop)
LEFT JOIN ps_carrier_zone AS cz USING (id_carrier)WHERE `id_zone` IN (SELECT id_zone FROM `ps_country` AS tmpz WHERE tmpz.`iso_code` LIKE 'IT%' AND tmpz.`active` = 1 AND tmpz.id_zone > 0 GROUP BY tmpz.id_zone) AND `active` = 1 AND deleted = 0 AND cl.`id_lang` = 5 AND cs.id_shop = 1 GROUP BY id_reference ORDER BY position ASC, id_carrier DESC |
0.945
ms
|
19 |
Yes
|
Yes
|
/modules/estimateddelivery/estimateddelivery.php:3078
/modules/estimateddelivery/estimateddelivery.php:5568 (getIpCarriers)
/modules/estimateddelivery/estimateddelivery.php:5345 (getEDCarriers)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 88 |
SELECT SQL_NO_CACHE cp.`id_category`, cl.`name`, cl.`link_rewrite` FROM `ps_category_product` cp
LEFT JOIN `ps_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `ps_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` = 1536
AND cl.`id_lang` = 5 |
0.924
ms
|
7 |
|
|
/classes/Product.php:3459
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:1020 (getProductCategoriesFull)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:995 (addViewedProductData)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:983 (setupViewedProduct)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:676 (setupProductEvents)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 460 |
SELECT SQL_NO_CACHE id_carrier, id_range_price, delimiter1, delimiter2 FROM ps_range_price AS tmp LEFT JOIN ps_carrier USING (id_carrier) WHERE active = 1 ORDER BY delimiter1 ASC |
0.826
ms
|
168 |
Yes
|
|
/modules/estimateddelivery/estimateddelivery.php:4565
/modules/estimateddelivery/estimateddelivery.php:4347 (getCarriersRange)
/modules/estimateddelivery/estimateddelivery.php:4276 (applyRestrictionsToCarriers)
/modules/estimateddelivery/estimateddelivery.php:3492 (getAvailableCarriersForED)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 450 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1536
AND pa.`id_product_attribute` = 1946
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.697
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/estimateddelivery/classes/DeliveryProduct.php:260 (getAttributeCombinationsById)
/modules/estimateddelivery/classes/DeliveryProduct.php:131 (loadCombinationData)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 341 |
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
LEFT JOIN `ps_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `ps_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN ps_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536
AND al.`id_lang` = 5
AND agl.`id_lang` = 5
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC |
0.647
ms
|
2 |
Yes
|
Yes
|
/classes/Product.php:4598
/controllers/front/ProductController.php:644 (getAttributesGroups)
/controllers/front/ProductController.php:462 (assignAttributesGroups)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 523 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1824) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.636
ms
|
7 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 580 |
SELECT SQL_NO_CACHE `id_guest`
FROM `ps_connections`
WHERE `id_guest` = 1590912
AND `date_add` > '2025-10-28 13:52:00'
AND id_shop IN (1)
ORDER BY `date_add` DESC LIMIT 1 |
0.621
ms
|
1 |
Yes
|
|
/classes/Connection.php:168
/classes/Connection.php:97 (setNewConnection)
/modules/statsdata/statsdata.php:118 (setPageConnection)
/modules/statsdata/statsdata.php:74 (getScriptCustomerPagesViews)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 95 |
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `ps_category` c
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 5 AND cl.id_shop = 1 )
LEFT JOIN `ps_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 499
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC |
0.608
ms
|
1 |
Yes
|
Yes
|
/classes/Category.php:924
/controllers/front/ProductController.php:897 (getSubCategories)
/controllers/front/ProductController.php:368 (assignCategory)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 55 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) AND (b.`id_shop` = 1) LIMIT 1 |
0.568
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 464 |
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-10-28 00:00:00',
INTERVAL 200 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 5
LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1536) |
0.560
ms
|
1 |
|
|
/classes/ProductAssembler.php:64
/classes/ProductAssembler.php:182 (addMissingProductFields)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 467 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.550
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 312 |
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
LEFT JOIN `ps_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `ps_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN ps_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536
AND al.`id_lang` = 5
AND agl.`id_lang` = 5
AND product_attribute_shop.`id_product_attribute` = 1946 GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC |
0.550
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4598
/controllers/front/ProductController.php:1308 (getAttributesGroups)
/controllers/front/ProductController.php:1259 (findProductCombinationById)
/controllers/front/ProductController.php:1206 (getProductMinimalQuantity)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 96 |
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 5
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC |
0.543
ms
|
8 |
Yes
|
Yes
|
/classes/Category.php:1151
/classes/Category.php:1087 (getChildren)
/controllers/front/ProductController.php:907 (getHomeCategories)
/controllers/front/ProductController.php:368 (assignCategory)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 149 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1531 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1531 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.532
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 591 |
SELECT SQL_NO_CACHE c.*, cl.* FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 796 AND c.`nright` >= 797 AND c.`nleft` >= 2 AND c.`nright` <= 1307 ORDER BY `nleft` DESC |
0.531
ms
|
654 |
Yes
|
|
/classes/Category.php:1600
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 138 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 685 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 685 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.527
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 474 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1536
ORDER BY `position` |
0.505
ms
|
7 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:55 (present)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:64 (createProductLazyArrayFromArray)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 469 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1945
AND cp.`id_cart` = 0 AND cp.`id_product` = 1536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1945
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.498
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 179 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1948
AND cp.`id_cart` = 0 AND cp.`id_product` = 1537 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1948
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1537 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.494
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 314 |
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
LEFT JOIN `ps_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `ps_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN ps_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536
AND al.`id_lang` = 5
AND agl.`id_lang` = 5
AND product_attribute_shop.`id_product_attribute` = 1946 GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC |
0.491
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4598
/controllers/front/ProductController.php:1308 (getAttributesGroups)
/controllers/front/ProductController.php:1259 (findProductCombinationById)
/controllers/front/ProductController.php:1324 (getProductMinimalQuantity)
/controllers/front/ProductController.php:1208 (getRequiredQuantity)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 531 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1825) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.488
ms
|
7 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 604 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "badge" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.454
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:400 (displayBlock)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 524 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2284
AND agl.`id_lang` = 5 |
0.453
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 98 |
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`id_attribute_group`, al.`name` as `attribute`, agl.`name` as `group`,pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
INNER JOIN ps_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = pac.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536 |
0.448
ms
|
2 |
|
|
/classes/Product.php:7563
/controllers/front/ProductController.php:866 (getAttributesInformationsByProduct)
/controllers/front/ProductController.php:373 (assignAttributesCombinations)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 471 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1536
AND pac.`id_product_attribute` = 1945
AND agl.`id_lang` = 5 |
0.448
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:5857 (getAttributesParams)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 283 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1531
ORDER BY `position` |
0.429
ms
|
7 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 390 |
SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-10-28 00:00:00" AND date_to <= "2025-10-28 23:59:59") OR (date_from >= "2025-10-28 00:00:00" AND date_from <= "2025-10-28 23:59:59") OR (date_from < "2025-10-28 00:00:00" AND date_to > "2025-10-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.429
ms
|
71 |
|
|
/classes/CartRule.php:357
/classes/CartRule.php:389 (haveCartRuleToday)
/override/classes/CartRule.php:108 (getCustomerCartRules)
/classes/Cart.php:3079 (getCustomerCartRules)
/classes/Cart.php:3463 (getDeliveryOptionList)
/classes/Cart.php:3536 (getDeliveryOption)
/src/Core/Cart/Fees.php:96 (getTotalShippingCost)
/src/Core/Cart/Calculator.php:354 (processCalculation)
/src/Core/Cart/Calculator.php:155 (calculateFees)
/classes/Cart.php:2201 (processCalculation)
/src/Adapter/Presenter/Cart/CartLazyArray.php:185 (getOrderTotal)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getTotals)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 313 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1946
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1946
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.422
ms
|
0 |
|
|
/classes/Cart.php:1430
/controllers/front/ProductController.php:1207 (getProductQuantity)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 37 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.417
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/iqitthemeeditor/iqitthemeeditor.php:40 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:507 (exec)
/index.php:39 (dispatch)
|
| 226 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1617 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1617 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.414
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 292 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1539
ORDER BY `position` |
0.411
ms
|
8 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 235 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1821 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1821 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.411
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 27 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.410
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/giftcard/giftcard.php:76 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 348 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) AND (b.`id_shop` = 1) LIMIT 1 |
0.409
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 556 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1543
ORDER BY `position` |
0.408
ms
|
3 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 462 |
SELECT SQL_NO_CACHE id_carrier, id_group
FROM ps_carrier_group |
0.405
ms
|
482 |
|
|
/modules/estimateddelivery/classes/DeliveryCarrier.php:137
/modules/estimateddelivery/classes/DeliveryCarrier.php:103 (getAllowedGroups)
/modules/estimateddelivery/classes/DeliveryCarrier.php:58 (isCarrierAllowed)
/modules/estimateddelivery/estimateddelivery.php:4302 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3492 (getAvailableCarriersForED)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 79 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1536
AND pac.`id_product_attribute` = 1946
AND agl.`id_lang` = 5 |
0.403
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/controllers/front/ProductController.php:99 (getProductLink)
/controllers/front/ProductController.php:158 (canonicalRedirection)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 295 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1540
ORDER BY `position` |
0.395
ms
|
5 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 457 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1536
AND pa.`id_product_attribute` = 1946
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.394
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/estimateddelivery/estimateddelivery.php:4446 (getAttributeCombinationsById)
/modules/estimateddelivery/estimateddelivery.php:3473 (getCurrentOrderPriceAndWeight)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 287 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1534
ORDER BY `position` |
0.387
ms
|
3 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 547 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1821
ORDER BY `position` |
0.384
ms
|
2 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 326 |
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 )
LEFT JOIN `ps_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `ps_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN ps_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536
AND al.`id_lang` = 5
AND agl.`id_lang` = 5
AND product_attribute_shop.`id_product_attribute` = 1946 GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC |
0.376
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4598
/controllers/front/ProductController.php:1308 (getAttributesGroups)
/controllers/front/ProductController.php:1280 (findProductCombinationById)
/controllers/front/ProductController.php:1211 (getProductEcotax)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 507 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1537) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.376
ms
|
2 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 260 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2282
AND agl.`id_lang` = 5 |
0.375
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:5857 (getAttributesParams)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 431 |
SELECT SQL_NO_CACHE MIN(price) as omniversepricing_price FROM `ps_omniversepricing_products` oc
WHERE oc.`lang_id` = 5 AND oc.`shop_id` = 1
AND oc.`product_id` = 1536 AND oc.date > "2025-09-27" AND oc.price != "22.000004" AND oc.`id_product_attribute` = 1946 AND oc.id_omniversepricing IN (SELECT oc2.id_omniversepricing FROM `ps_omniversepricing_products` oc2
WHERE oc2.`id_currency` = 1 OR oc2.`id_country` = 10 OR oc2.`id_group` IN (1)) UNION SELECT MIN(price) as omniversepricing_price FROM `ps_omniversepricing_products` oc
WHERE oc.`lang_id` = 5 AND oc.`shop_id` = 1
AND oc.`product_id` = 1536 AND oc.date > "2025-09-27" AND oc.price != "22.000004" AND oc.`id_product_attribute` = 1946 AND oc.`id_currency` = 0 AND oc.`id_country` = 0 |
0.371
ms
|
0 |
|
|
/modules/omniversepricing/omniversepricing.php:1251
/modules/omniversepricing/omniversepricing.php:1061 (omniversepricing_get_price)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 481 |
SELECT SQL_NO_CACHE c.*, cl.`payment_name`, cl.`payment_text`
FROM `ps_codfee_configuration` c
LEFT JOIN `ps_codfee_configuration_lang` cl ON (c.`id_codfee_configuration` = cl.`id_codfee_configuration` AND cl.`id_lang` = 5)
WHERE c.`id_shop` = 1
AND c.`active` = 1
ORDER BY `position` ASC; |
0.366
ms
|
1 |
Yes
|
|
/modules/codfee/classes/CodfeeConfiguration.php:164
/modules/codfee/codfee.php:962 (getFeeConfiguration)
/modules/codfee/codfee.php:919 (hookDisplayRightColumnProduct)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 510 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1539) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.366
ms
|
2 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 499 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (685) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.362
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 586 |
SELECT SQL_NO_CACHE c.*, cl.* FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 119 AND c.`nright` >= 120 AND c.`nleft` >= 2 AND c.`nright` <= 1307 ORDER BY `nleft` DESC |
0.359
ms
|
61 |
|
|
/classes/Category.php:1600
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 291 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1949, 1948) AND il.`id_lang` = 5 ORDER by i.`position` |
0.356
ms
|
6 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 305 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1824
ORDER BY `position` |
0.354
ms
|
16 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 368 |
SELECT SQL_NO_CACHE image_shop.`id_image` id_image, il.`legend`
FROM `ps_image` i
INNER JOIN `ps_image_shop` image_shop
ON (i.id_image = image_shop.id_image AND image_shop.id_shop = 1)
INNER JOIN `ps_product_attribute_image` pai
ON (pai.`id_image` = i.`id_image` AND pai.`id_product_attribute` = 1946)
LEFT JOIN `ps_image_lang` il
ON (image_shop.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1536 ORDER BY i.`position` ASC LIMIT 1 |
0.343
ms
|
3 |
Yes
|
|
/classes/Image.php:245
/modules/fabfacebookpixel/libs/FFPProductInfoTrait.php:121 (getBestImageAttribute)
/modules/fabfacebookpixel/fabfacebookpixel.php:504 (fillAndReturnData)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 308 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1825
ORDER BY `position` |
0.342
ms
|
14 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 505 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1534) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.340
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 508 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1537
AND pac.`id_product_attribute` = 1949
AND agl.`id_lang` = 5 |
0.335
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 501 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1531) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.334
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 279 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 685
ORDER BY `position` |
0.330
ms
|
3 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 532 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2291
AND agl.`id_lang` = 5 |
0.325
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 391 |
SELECT SQL_NO_CACHE * FROM `ps_cart_rule` cr
LEFT JOIN `ps_cart_rule_lang` crl
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 5) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1 |
0.323
ms
|
8 |
|
|
/classes/CartRule.php:423
/override/classes/CartRule.php:108 (getCustomerCartRules)
/classes/Cart.php:3079 (getCustomerCartRules)
/classes/Cart.php:3463 (getDeliveryOptionList)
/classes/Cart.php:3536 (getDeliveryOption)
/src/Core/Cart/Fees.php:96 (getTotalShippingCost)
/src/Core/Cart/Calculator.php:354 (processCalculation)
/src/Core/Cart/Calculator.php:155 (calculateFees)
/classes/Cart.php:2201 (processCalculation)
/src/Adapter/Presenter/Cart/CartLazyArray.php:185 (getOrderTotal)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getTotals)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 77 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1946) LIMIT 1 |
0.321
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/controllers/front/ProductController.php:1537 (__construct)
/controllers/front/ProductController.php:85 (isValidCombination)
/controllers/front/ProductController.php:158 (canonicalRedirection)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 30 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.320
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/ps_mbo/ps_mbo.php:106 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 587 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1536
AND pa.`id_product_attribute` = 1946
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.320
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:133 (getAttributeCombinationsById)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:82 (getCombinationsData)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 503 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.319
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 525 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2286
AND agl.`id_lang` = 5 |
0.315
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 139 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 685
ORDER BY f.position ASC |
0.312
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 549 |
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-10-28 00:00:00',
INTERVAL 200 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 5
LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1533) |
0.309
ms
|
1 |
|
|
/classes/ProductAssembler.php:64
/classes/ProductAssembler.php:182 (addMissingProductFields)
/modules/iqitcrossselling/iqitcrossselling.php:351 (assembleProduct)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 130 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 685
AND image_shop.`cover` = 1 LIMIT 1 |
0.308
ms
|
3 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 301 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1821
ORDER BY `position` |
0.306
ms
|
2 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 596 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1537
AND pa.`id_product_attribute` = 1948
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.304
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:133 (getAttributeCombinationsById)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:82 (getCombinationsData)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 602 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pa.`id_product_attribute` = 2282
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.302
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:133 (getAttributeCombinationsById)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:82 (getCombinationsData)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 521 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1822) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.301
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 526 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2283
AND agl.`id_lang` = 5 |
0.299
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 601 |
SELECT SQL_NO_CACHE c.*, cl.* FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 800 AND c.`nright` >= 801 AND c.`nleft` >= 2 AND c.`nright` <= 1307 ORDER BY `nleft` DESC |
0.297
ms
|
654 |
Yes
|
|
/classes/Category.php:1600
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 559 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1821) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.297
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 527 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2287
AND agl.`id_lang` = 5 |
0.295
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 151 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1533
AND image_shop.`cover` = 1 LIMIT 1 |
0.294
ms
|
4 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 344 |
SELECT SQL_NO_CACHE * FROM ps_presta_manage_minimum_order_amount
WHERE `id_shop` = 1 AND `active` = 1
ORDER BY `position` ASC |
0.294
ms
|
1 |
Yes
|
|
/modules/prestaminimumorderamount/classes/PrestaMinimumOrderRule.php:133
/modules/prestaminimumorderamount/classes/PrestaMinimumOrderRule.php:141 (getAllRules)
/modules/prestaminimumorderamount/prestaminimumorderamount.php:57 (getMinimumOrderAmount)
/classes/Hook.php:1077 (hookActionPresentCart)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/src/Adapter/Presenter/Cart/CartPresenter.php:213 (exec)
/classes/controller/FrontController.php:557 (present)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 22 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.292
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/ph_simpleblog/ph_simpleblog.php:135 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 217 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.292
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 310 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (2289, 2290, 2291, 2292, 2293, 2294, 2295) AND il.`id_lang` = 5 ORDER by i.`position` |
0.292
ms
|
14 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 75 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 5
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.292
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 167 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1534 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1534 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.292
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 515 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.292
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 519 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1821) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.291
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 177 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1537 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1537 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.290
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 517 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1617) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.289
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 60 |
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 32
AND tr.`id_state` IN (0, 208)
AND ('42021' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '42021')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.288
ms
|
1 |
|
|
/classes/tax/TaxRulesTaxManager.php:109
/classes/Product.php:6899 (getTaxCalculator)
/classes/Product.php:741 (getTaxesRate)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 395 |
SELECT SQL_NO_CACHE *, qdrl.`name`, '' as id_customer
FROM `ps_quantity_discount_rule` qdr
LEFT JOIN `ps_quantity_discount_rule_lang` qdrl ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
WHERE qdr.`active` = 1 AND `id_family` = 1 AND `code` != '' AND `highlight` = 1 ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.288
ms
|
7 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:258
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:366 (getQuantityDiscountRulesByFamily)
/override/classes/CartRule.php:114 (getHighlightedQuantityDiscountRules)
/override/classes/CartRule.php:153 (getCustomerCartRules)
/classes/Cart.php:522 (getCustomerHighlightedDiscounts)
/src/Adapter/Presenter/Cart/CartLazyArray.php:396 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 158 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1533 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1533 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.287
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 169 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1537
AND image_shop.`cover` = 1 LIMIT 1 |
0.287
ms
|
6 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 141 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1531
AND image_shop.`cover` = 1 LIMIT 1 |
0.286
ms
|
7 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 257 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 2282
AND cp.`id_cart` = 0 AND cp.`id_product` = 1824 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 2282
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1824 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.286
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 597 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1539
AND pa.`id_product_attribute` = 1951
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.286
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:133 (getAttributeCombinationsById)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:82 (getCombinationsData)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 533 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2293
AND agl.`id_lang` = 5 |
0.285
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 150 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1531
ORDER BY f.position ASC |
0.285
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 33 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.283
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/pagecache/pagecache.php:196 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 193 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.283
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 208 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.283
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 546 |
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-10-28 00:00:00',
INTERVAL 200 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 5
LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1821) |
0.281
ms
|
1 |
|
|
/classes/ProductAssembler.php:64
/classes/ProductAssembler.php:182 (addMissingProductFields)
/modules/iqitcrossselling/iqitcrossselling.php:351 (assembleProduct)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 555 |
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-10-28 00:00:00',
INTERVAL 200 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 5
LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1543) |
0.281
ms
|
1 |
|
|
/classes/ProductAssembler.php:64
/classes/ProductAssembler.php:182 (addMissingProductFields)
/modules/iqitcrossselling/iqitcrossselling.php:351 (assembleProduct)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 528 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2288
AND agl.`id_lang` = 5 |
0.280
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 603 |
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*, ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, al.`name` AS attribute_name,
a.`id_attribute`, a.`position`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_combination` pac ON pac.`id_product_attribute` = pa.`id_product_attribute`
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pa.`id_product_attribute` = 2289
GROUP BY pa.`id_product_attribute`,ag.`id_attribute_group`
ORDER BY pa.`id_product_attribute` |
0.280
ms
|
1 |
|
Yes
|
/classes/Product.php:2862
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:133 (getAttributeCombinationsById)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:82 (getCombinationsData)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 271 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1825 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1825 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.278
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 255 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1824 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1824 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.276
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 534 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2290
AND agl.`id_lang` = 5 |
0.276
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 482 |
SELECT SQL_NO_CACHE * FROM `ps_cart_rule` cr
LEFT JOIN `ps_cart_rule_lang` crl
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 5) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1 |
0.276
ms
|
8 |
|
|
/classes/CartRule.php:423
/override/classes/CartRule.php:108 (getCustomerCartRules)
/classes/Cart.php:3079 (getCustomerCartRules)
/modules/codfee/classes/CodfeeConfiguration.php:231 (getDeliveryOptionList)
/modules/codfee/codfee.php:962 (getFeeConfiguration)
/modules/codfee/codfee.php:919 (hookDisplayRightColumnProduct)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 195 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1951
AND cp.`id_cart` = 0 AND cp.`id_product` = 1539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1951
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.275
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 245 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1822 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1822 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.275
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 24 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.273
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/ps_checkout/ps_checkout.php:149 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 26 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.273
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:130 (__construct)
/modules/klaviyopsautomation/klaviyopsautomation.php:43 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 535 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2294
AND agl.`id_lang` = 5 |
0.272
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 237 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1822
AND image_shop.`cover` = 1 LIMIT 1 |
0.271
ms
|
2 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 273 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 2289
AND cp.`id_cart` = 0 AND cp.`id_product` = 1825 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 2289
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1825 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.271
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 536 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2295
AND agl.`id_lang` = 5 |
0.270
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 285 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1533
ORDER BY `position` |
0.269
ms
|
4 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 182 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1537
AND pac.`id_product_attribute` = 1948
AND agl.`id_lang` = 5 |
0.268
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:5857 (getAttributesParams)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 497 |
SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_product c LEFT JOIN ps_iqit_elementor_product_shop s ON c.id_elementor = s.id_elementor WHERE c.id_product = 1536 AND s.id_shop = 1 LIMIT 1 |
0.268
ms
|
1 |
|
|
/modules/iqitelementor/src/IqitElementorProduct.php:74
/modules/iqitelementor/iqitelementor.php:640 (getIdByProduct)
/modules/iqitelementor/iqitelementor.php:593 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/67/0d/6a/670d6a2602ad93d843549aaff60e05819c22c5a1_2.file.product-tabs-h.tpl.php:163 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/67/0d/6a/670d6a2602ad93d843549aaff60e05819c22c5a1_2.file.product-tabs-h.tpl.php:30 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31545a823_09666447)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:663 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1027 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 185 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1539
AND image_shop.`cover` = 1 LIMIT 1 |
0.267
ms
|
8 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 297 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1543
ORDER BY `position` |
0.267
ms
|
3 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 529 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1824
AND pac.`id_product_attribute` = 2285
AND agl.`id_lang` = 5 |
0.266
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 25 |
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1 |
0.265
ms
|
135 |
|
|
/classes/module/Module.php:346
/modules/doofinder/doofinder.php:47 (__construct)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 537 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2292
AND agl.`id_lang` = 5 |
0.264
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 133 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 685) AND (b.`id_shop` = 1) LIMIT 1 |
0.264
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 354 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 4
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) AND (b.`id_shop` = 1) LIMIT 1 |
0.264
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 299 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1617
ORDER BY `position` |
0.263
ms
|
4 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 160 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1534
AND image_shop.`cover` = 1 LIMIT 1 |
0.262
ms
|
3 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 210 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1543
AND image_shop.`cover` = 1 LIMIT 1 |
0.262
ms
|
3 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 289 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1537
ORDER BY `position` |
0.262
ms
|
6 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 350 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) AND (b.`id_shop` = 1) LIMIT 1 |
0.262
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 352 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 3
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) AND (b.`id_shop` = 1) LIMIT 1 |
0.262
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 125 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1824 LIMIT 1 |
0.258
ms
|
7 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 281 |
SELECT SQL_NO_CACHE state FROM ps_feature_flag WHERE name = 'multiple_image_format' LIMIT 1 |
0.258
ms
|
1 |
|
|
/classes/FeatureFlag.php:105
/src/Core/Image/ImageFormatConfiguration.php:69 (isEnabled)
/src/Adapter/Image/ImageRetriever.php:209 (getGenerationFormats)
/src/Adapter/Image/ImageRetriever.php:111 (getImage)
:undefined (PrestaShop\PrestaShop\Adapter\Image\{closure})
/src/Adapter/Image/ImageRetriever.php:104 (array_map)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 201 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1540
AND image_shop.`cover` = 1 LIMIT 1 |
0.256
ms
|
5 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 402 |
SELECT SQL_NO_CACHE *
FROM `ps_iqit_elementor_content` a
LEFT JOIN `ps_iqit_elementor_content_lang` `b` ON a.`id_elementor` = b.`id_elementor` AND b.`id_lang` = 5
LEFT JOIN `ps_iqit_elementor_content_shop` `c` ON a.`id_elementor` = c.`id_elementor` AND c.`id_shop` = 1
WHERE (a.`id_elementor` = 4) AND (b.`id_shop` = 1) LIMIT 1 |
0.256
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/modules/iqitelementor/src/IqitElementorContent.php:62 (__construct)
/modules/iqitelementor/iqitelementor.php:720 (__construct)
/modules/iqitelementor/iqitelementor.php:593 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:75 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:38 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 276 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1825
AND pac.`id_product_attribute` = 2289
AND agl.`id_lang` = 5 |
0.256
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:5857 (getAttributesParams)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 144 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1531) AND (b.`id_shop` = 1) LIMIT 1 |
0.255
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 228 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1821
AND image_shop.`cover` = 1 LIMIT 1 |
0.255
ms
|
2 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 198 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1539
AND pac.`id_product_attribute` = 1951
AND agl.`id_lang` = 5 |
0.253
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:5857 (getAttributesParams)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 78 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1946 |
0.252
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/controllers/front/ProductController.php:1537 (__construct)
/controllers/front/ProductController.php:85 (isValidCombination)
/controllers/front/ProductController.php:158 (canonicalRedirection)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 366 |
SELECT SQL_NO_CACHE *
FROM `ps_product_lang`
WHERE `id_product` = 1536 AND `id_shop` = 1 |
0.252
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/modules/fabfacebookpixel/fabfacebookpixel.php:544 (__construct)
/modules/fabfacebookpixel/fabfacebookpixel.php:539 (tryToGetAvailableIdProductAttribute)
/modules/fabfacebookpixel/fabfacebookpixel.php:502 (getIdProductAttributeByGroupOrRequestOrDefault)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 21 |
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `ps_hook` |
0.249
ms
|
1153 |
|
|
/classes/Hook.php:1326
/classes/Hook.php:225 (getAllHookIds)
/classes/Hook.php:851 (getIdByName)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 1 |
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM ps_shop_group gs
LEFT JOIN ps_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN ps_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name |
0.247
ms
|
2 |
Yes
|
|
/classes/shop/Shop.php:715
/classes/shop/Shop.php:774 (cacheShops)
/classes/Configuration.php:299 (getShops)
/classes/shop/Shop.php:398 (getMultiShopValues)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 360 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a0
LEFT JOIN `ps_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 119) AND (a0.`nright` > 120) AND (a1.`id_lang` = 5) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc |
0.247
ms
|
61 |
|
|
/classes/PrestaShopCollection.php:383
/classes/PrestaShopCollection.php:440 (getAll)
/controllers/front/ProductController.php:1342 (rewind)
/classes/controller/FrontController.php:1876 (getBreadcrumbLinks)
/classes/controller/FrontController.php:568 (getBreadcrumb)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 477 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayWhatsAppProductSocialButtons" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.247
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:445 (displayBlock)
/modules/whatsappchat/whatsappchat.php:435 (hookDisplayWhatsAppProductSocialButtons)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/modules/stripe_official/stripe_official.php:541 (exec)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 349 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.246
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 484 |
SELECT SQL_NO_CACHE DISTINCT(qdr.`id_quantity_discount_rule`)
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_lang` qdrl
ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
INNER JOIN `ps_quantity_discount_rule_message` qdrm
ON (qdrm.`id_quantity_discount_rule` = qdr.`id_quantity_discount_rule` AND qdrm.`hook_name` = 'hookDisplayProductAdditionalInfo')
INNER JOIN `ps_quantity_discount_rule_message_lang` qdrml
ON (qdrm.`id_quantity_discount_rule_message` = qdrml.`id_quantity_discount_rule_message` AND qdrml.`id_lang` = 5)
WHERE qdr.`active` = 1
AND qdr.`id_shop` = 1 AND `id_family` = 1
ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.246
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:307
/modules/quantitydiscountpro/quantitydiscountpro.php:824 (getQuantityDiscountRulesByFamilyForMessages)
/modules/quantitydiscountpro/quantitydiscountpro.php:655 (getMessage)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 441 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayWhatsAppProductSocialButtons" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.245
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:445 (displayBlock)
/modules/whatsappchat/whatsappchat.php:450 (hookDisplayWhatsAppProductSocialButtons)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 140 |
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 32
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.244
ms
|
1 |
|
|
/classes/tax/TaxRulesTaxManager.php:109
/classes/Product.php:5972 (getTaxCalculator)
/classes/Product.php:5864 (getTaxesInformations)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 476 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1946, 1945) AND il.`id_lang` = 5 ORDER by i.`position` |
0.243
ms
|
7 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:55 (present)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:64 (createProductLazyArrayFromArray)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 561 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.242
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 565 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.242
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 540 |
SELECT SQL_NO_CACHE *
FROM `ps_absfreqbought` a
WHERE (a.`id_absfreqbought` = 1010) LIMIT 1 |
0.240
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:60 (__construct)
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:1582 (__construct)
/modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php:737 (createList)
/classes/Hook.php:1077 (hookdisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 563 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1531) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.239
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 343 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1946, 1945) AND il.`id_lang` = 5 ORDER by i.`position` |
0.238
ms
|
7 |
Yes
|
|
/classes/Product.php:2921
/controllers/front/ProductController.php:646 (getCombinationImages)
/controllers/front/ProductController.php:462 (assignAttributesGroups)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 209 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1540
ORDER BY f.position ASC |
0.237
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 153 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1533) AND (b.`id_shop` = 1) LIMIT 1 |
0.236
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 218 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1543
ORDER BY f.position ASC |
0.231
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 494 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayWhatsAppProductSocialButtons" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.231
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:445 (displayBlock)
/modules/whatsappchat/whatsappchat.php:435 (hookDisplayWhatsAppProductSocialButtons)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:101 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:32 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c315415fe6_66995437)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:483 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:549 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 576 |
SELECT SQL_NO_CACHE DISTINCT(qdr.`id_quantity_discount_rule`)
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_lang` qdrl
ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
INNER JOIN `ps_quantity_discount_rule_message` qdrm
ON (qdrm.`id_quantity_discount_rule` = qdr.`id_quantity_discount_rule` AND qdrm.`hook_name` = 'hookDisplayFooter')
INNER JOIN `ps_quantity_discount_rule_message_lang` qdrml
ON (qdrm.`id_quantity_discount_rule_message` = qdrml.`id_quantity_discount_rule_message` AND qdrml.`id_lang` = 5)
WHERE qdr.`active` = 1
AND qdr.`id_shop` = 1 AND `id_family` = 1
ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.231
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:307
/modules/quantitydiscountpro/quantitydiscountpro.php:824 (getQuantityDiscountRulesByFamilyForMessages)
/modules/quantitydiscountpro/quantitydiscountpro.php:469 (getMessage)
/classes/Hook.php:1077 (hookDisplayFooter)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:62 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 20 |
SELECT SQL_NO_CACHE `name`, `alias` FROM `ps_hook_alias` |
0.230
ms
|
87 |
|
|
/classes/Hook.php:287
/classes/Hook.php:318 (getAllHookAliases)
/classes/Hook.php:746 (getHookAliasesFor)
/classes/Hook.php:842 (getHookModuleExecList)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 181 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1537
ORDER BY f.position ASC |
0.230
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 236 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1821
ORDER BY f.position ASC |
0.230
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 433 |
SELECT SQL_NO_CACHE DISTINCT(qdr.`id_quantity_discount_rule`)
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_lang` qdrl
ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
INNER JOIN `ps_quantity_discount_rule_message` qdrm
ON (qdrm.`id_quantity_discount_rule` = qdr.`id_quantity_discount_rule` AND qdrm.`hook_name` = 'hookDisplayProductPriceBlockProduct')
INNER JOIN `ps_quantity_discount_rule_message_lang` qdrml
ON (qdrm.`id_quantity_discount_rule_message` = qdrml.`id_quantity_discount_rule_message` AND qdrml.`id_lang` = 5)
WHERE qdr.`active` = 1
AND qdr.`id_shop` = 1 AND `id_family` = 1
ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.230
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:307
/modules/quantitydiscountpro/quantitydiscountpro.php:824 (getQuantityDiscountRulesByFamilyForMessages)
/modules/quantitydiscountpro/quantitydiscountpro.php:714 (getMessage)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 227 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1617
ORDER BY f.position ASC |
0.229
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 159 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1533
ORDER BY f.position ASC |
0.229
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 294 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1952, 1951) AND il.`id_lang` = 5 ORDER by i.`position` |
0.228
ms
|
6 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 365 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1536) LIMIT 1 |
0.228
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/modules/fabfacebookpixel/fabfacebookpixel.php:544 (__construct)
/modules/fabfacebookpixel/fabfacebookpixel.php:539 (tryToGetAvailableIdProductAttribute)
/modules/fabfacebookpixel/fabfacebookpixel.php:502 (getIdProductAttributeByGroupOrRequestOrDefault)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 168 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1534
ORDER BY f.position ASC |
0.226
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 246 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1822
ORDER BY f.position ASC |
0.223
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 91 |
SELECT SQL_NO_CACHE * FROM `ps_image_shop` image_shop
WHERE image_shop.`id_product` = 1536
AND image_shop.`cover`= 1 LIMIT 1 |
0.222
ms
|
14 |
|
|
/classes/Image.php:401
/modules/klaviyopsautomation/classes/BusinessLogicServices/ProductPayloadService.php:235 (getCover)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:1043 (buildProductImageUrls)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:995 (addViewedProductData)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:983 (setupViewedProduct)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:676 (setupProductEvents)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 478 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayProductActions" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.222
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:435 (displayBlock)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/modules/stripe_official/stripe_official.php:541 (exec)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 197 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1539
ORDER BY f.position ASC |
0.221
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 513 |
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 5)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC; |
0.221
ms
|
1 |
Yes
|
Yes
|
/classes/Product.php:4524
/src/Adapter/Product/ProductColorsRetriever.php:43 (getAttributesColorList)
/src/Adapter/Presenter/Product/ProductLazyArray.php:528 (getColoredVariants)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 573 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "bottomWidth" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.220
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:337 (displayBlock)
/classes/Hook.php:1077 (hookDisplayFooter)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:62 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 389 |
SELECT SQL_NO_CACHE 1 FROM ps_cart_product cp INNER JOIN ps_product p
ON (p.id_product = cp.id_product) INNER JOIN ps_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1 |
0.219
ms
|
1 |
|
|
/classes/Cart.php:4255
/classes/Cart.php:4230 (hasProducts)
/classes/Cart.php:2145 (isVirtualCart)
/src/Adapter/Presenter/Cart/CartLazyArray.php:185 (getOrderTotal)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getTotals)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 569 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayWrapperBottom" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.218
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:548 (displayBlock)
/classes/Hook.php:1077 (hookDisplayWrapperBottom)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:509 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:144 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 538 |
SELECT SQL_NO_CACHE p.id_product, stock.`out_of_stock`, product_shop.`minimal_quantity`, IFNULL(stock.quantity, 0) as quantity FROM `ps_product` p LEFT JOIN ps_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) WHERE p.`id_product`=1536 AND product_shop.`active`=1 AND product_shop.`visibility` IN ("both", "catalog") HAVING quantity>=product_shop.minimal_quantity AND quantity>0 |
0.218
ms
|
1 |
|
|
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:2846
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:1578 (isValidProduct)
/modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php:737 (createList)
/classes/Hook.php:1077 (hookdisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 275 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1825
ORDER BY f.position ASC |
0.217
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 259 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1824
ORDER BY f.position ASC |
0.215
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 330 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.214
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5802 (getQuantity)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 511 |
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 5)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 5)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 5)
WHERE pa.`id_product` = 1539
AND pac.`id_product_attribute` = 1952
AND agl.`id_lang` = 5 |
0.214
ms
|
1 |
|
|
/classes/Product.php:7534
/classes/Product.php:7667 (getAttributesParams)
/classes/Link.php:249 (getAnchor)
/src/Adapter/Presenter/Product/ProductLazyArray.php:918 (getProductLink)
/src/Adapter/Presenter/Product/ProductLazyArray.php:539 (getProductURL)
:undefined (PrestaShop\PrestaShop\Adapter\Presenter\Product\{closure})
/src/Adapter/Presenter/Product/ProductLazyArray.php:534 (array_map)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getMainVariants)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:196 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:344 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 337 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1536
ORDER BY `position` |
0.210
ms
|
7 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/controllers/front/ProductController.php:1245 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 495 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayProductActions" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.210
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:435 (displayBlock)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:101 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:32 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c315415fe6_66995437)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:483 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:549 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 82 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 5
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 499) AND (b.`id_shop` = 1) LIMIT 1 |
0.208
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Category.php:164 (__construct)
/controllers/front/ProductController.php:303 (__construct)
/controllers/front/ProductController.php:170 (initializeCategory)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 134 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 685) |
0.205
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 461 |
SELECT SQL_NO_CACHE id_carrier, id_range_weight, delimiter1, delimiter2 FROM ps_range_weight AS tmp LEFT JOIN ps_carrier USING (id_carrier) WHERE active = 1 ORDER BY delimiter1 ASC |
0.205
ms
|
10 |
Yes
|
|
/modules/estimateddelivery/estimateddelivery.php:4565
/modules/estimateddelivery/estimateddelivery.php:4347 (getCarriersRange)
/modules/estimateddelivery/estimateddelivery.php:4276 (applyRestrictionsToCarriers)
/modules/estimateddelivery/estimateddelivery.php:3492 (getAvailableCarriersForED)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 359 |
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM ps_required_field |
0.204
ms
|
1 |
|
|
/classes/ObjectModel.php:1592
/classes/ObjectModel.php:1624 (getFieldsRequiredDatabase)
/classes/ObjectModel.php:1555 (cacheFieldsRequiredDatabase)
/classes/controller/FrontController.php:567 (validateFieldsRequiredDatabase)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 442 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayProductAdditionalInfo" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.203
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:450 (displayBlock)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 145 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1531) |
0.202
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 250 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 2282 LIMIT 1 |
0.201
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 553 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1531
ORDER BY `position` |
0.201
ms
|
7 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 171 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1537) AND (b.`id_shop` = 1) LIMIT 1 |
0.200
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 339 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1946, 1945) AND il.`id_lang` = 5 ORDER by i.`position` |
0.199
ms
|
7 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/controllers/front/ProductController.php:1245 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 14 |
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `ps_lang` l
JOIN ps_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1 |
0.198
ms
|
5 |
|
|
/classes/Language.php:1216
/classes/Language.php:1513 (countActiveLanguages)
/classes/Dispatcher.php:531 (isMultiLanguageActivated)
/classes/Dispatcher.php:232 (setRequestUri)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 552 |
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-10-28 00:00:00',
INTERVAL 200 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 5
LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1531) |
0.198
ms
|
1 |
|
|
/classes/ProductAssembler.php:64
/classes/ProductAssembler.php:182 (addMissingProductFields)
/modules/iqitcrossselling/iqitcrossselling.php:351 (assembleProduct)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 0 |
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM ps_shop_url su
LEFT JOIN ps_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.labelbike.it' OR su.domain_ssl = 'www.labelbike.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC |
0.198
ms
|
1 |
Yes
|
|
/classes/shop/Shop.php:1364
/classes/shop/Shop.php:355 (findShopByHost)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 458 |
SELECT SQL_NO_CACHE c.*
FROM `ps_product_carrier` pc
INNER JOIN `ps_carrier` c
ON (c.`id_reference` = pc.`id_carrier_reference` AND c.`deleted` = 0)
WHERE pc.`id_product` = 1536
AND pc.`id_shop` = 1 |
0.198
ms
|
2 |
|
|
/classes/Product.php:3492
/modules/estimateddelivery/estimateddelivery.php:4371 (getCarriers)
/modules/estimateddelivery/estimateddelivery.php:4259 (getProductCarriers)
/modules/estimateddelivery/estimateddelivery.php:3492 (getAvailableCarriersForED)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 550 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1533
ORDER BY `position` |
0.198
ms
|
4 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 203 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1540) AND (b.`id_shop` = 1) LIMIT 1 |
0.197
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 392 |
SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-10-28 00:00:00" AND date_to <= "2025-10-28 23:59:59") OR (date_from >= "2025-10-28 00:00:00" AND date_from <= "2025-10-28 23:59:59") OR (date_from < "2025-10-28 00:00:00" AND date_to > "2025-10-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.197
ms
|
71 |
|
|
/classes/CartRule.php:357
/classes/CartRule.php:389 (haveCartRuleToday)
/override/classes/CartRule.php:108 (getCustomerCartRules)
/override/classes/CartRule.php:153 (getCustomerCartRules)
/classes/Cart.php:522 (getCustomerHighlightedDiscounts)
/src/Adapter/Presenter/Cart/CartLazyArray.php:396 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 221 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1617) AND (b.`id_shop` = 1) LIMIT 1 |
0.196
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 162 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1534) AND (b.`id_shop` = 1) LIMIT 1 |
0.195
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 574 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayFooter" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.195
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:338 (displayBlock)
/classes/Hook.php:1077 (hookDisplayFooter)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:62 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 76 |
SELECT SQL_NO_CACHE pa.id_product_attribute
FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536 |
0.194
ms
|
2 |
|
|
/classes/Product.php:7496
/classes/Product.php:7576 (getProductAttributesIds)
/controllers/front/ProductController.php:85 (hasCombinations)
/controllers/front/ProductController.php:158 (canonicalRedirection)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 311 |
SELECT SQL_NO_CACHE pa.id_product_attribute
FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536 |
0.192
ms
|
2 |
|
|
/classes/Product.php:7496
/classes/Product.php:7576 (getProductAttributesIds)
/controllers/front/ProductController.php:1064 (hasCombinations)
/controllers/front/ProductController.php:1205 (getIdProductAttributeByGroupOrRequestOrDefault)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 187 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1539) AND (b.`id_shop` = 1) LIMIT 1 |
0.192
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 212 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1543) AND (b.`id_shop` = 1) LIMIT 1 |
0.191
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 230 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1821) AND (b.`id_shop` = 1) LIMIT 1 |
0.191
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 568 |
SELECT SQL_NO_CACHE DISTINCT(qdr.`id_quantity_discount_rule`)
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_lang` qdrl
ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
INNER JOIN `ps_quantity_discount_rule_message` qdrm
ON (qdrm.`id_quantity_discount_rule` = qdr.`id_quantity_discount_rule` AND qdrm.`hook_name` = 'hookDisplayFooterProduct')
INNER JOIN `ps_quantity_discount_rule_message_lang` qdrml
ON (qdrm.`id_quantity_discount_rule_message` = qdrml.`id_quantity_discount_rule_message` AND qdrml.`id_lang` = 5)
WHERE qdr.`active` = 1
AND qdr.`id_shop` = 1 AND `id_family` = 1
ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.191
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:307
/modules/quantitydiscountpro/quantitydiscountpro.php:824 (getQuantityDiscountRulesByFamilyForMessages)
/modules/quantitydiscountpro/quantitydiscountpro.php:670 (getMessage)
/classes/Hook.php:1077 (hookDisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 388 |
SELECT SQL_NO_CACHE *
FROM ps_attachment a
LEFT JOIN ps_attachment_lang al
ON (a.id_attachment = al.id_attachment AND al.id_lang = 5)
WHERE a.id_attachment IN (
SELECT pa.id_attachment
FROM ps_product_attachment pa
WHERE id_product = 1536
) |
0.190
ms
|
1 |
|
|
/classes/Attachment.php:174
/override/controllers/front/ProductController.php:16 (getAttachments)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 566 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayFooterProduct" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.190
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:465 (displayBlock)
/classes/Hook.php:1077 (hookDisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 606 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "floating" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.190
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:401 (displayBlock)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 97 |
SELECT SQL_NO_CACHE pa.id_product_attribute
FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1536 |
0.189
ms
|
2 |
|
|
/classes/Product.php:7496
/classes/Product.php:7576 (getProductAttributesIds)
/controllers/front/ProductController.php:1064 (hasCombinations)
/controllers/front/ProductController.php:604 (getIdProductAttributeByGroupOrRequestOrDefault)
/controllers/front/ProductController.php:370 (assignPriceAndTax)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 249 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1824) AND (b.`id_shop` = 1) LIMIT 1 |
0.189
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 265 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1825) AND (b.`id_shop` = 1) LIMIT 1 |
0.188
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 595 |
SELECT SQL_NO_CACHE c.*, cl.* FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 794 AND c.`nright` >= 795 AND c.`nleft` >= 2 AND c.`nright` <= 1307 ORDER BY `nleft` DESC |
0.187
ms
|
654 |
Yes
|
|
/classes/Category.php:1600
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 240 |
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 5
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1822) AND (b.`id_shop` = 1) LIMIT 1 |
0.186
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:725 (__construct)
/classes/Link.php:113 (__construct)
/classes/Link.php:189 (getProductObject)
/classes/Product.php:5660 (getProductLink)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 332 |
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1946
AND cp.`id_cart` = 0 AND cp.`id_product` = 1536 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1946
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1 |
0.185
ms
|
0 |
|
|
/classes/Cart.php:1430
/classes/Product.php:4361 (getProductQuantity)
/classes/Product.php:5814 (getQuantity)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 421 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "top" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.185
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:383 (displayBlock)
/classes/Hook.php:1077 (hookDisplayTop)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:159 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 415 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayNav1" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.184
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:414 (displayBlock)
/classes/Hook.php:1077 (hookDisplayNav1)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:91 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 303 |
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 5)
WHERE i.`id_product` = 1822
ORDER BY `position` |
0.183
ms
|
2 |
Yes
|
|
/classes/Product.php:3545
/src/Adapter/Image/ImageRetriever.php:84 (getImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 340 |
SELECT SQL_NO_CACHE *
FROM `ps_manufacturer` a
LEFT JOIN `ps_manufacturer_lang` `b` ON a.`id_manufacturer` = b.`id_manufacturer` AND b.`id_lang` = 5
LEFT JOIN `ps_manufacturer_shop` `c` ON a.`id_manufacturer` = c.`id_manufacturer` AND c.`id_shop` = 1
WHERE (a.`id_manufacturer` = 2) LIMIT 1 |
0.182
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Manufacturer.php:113 (__construct)
/controllers/front/ProductController.php:438 (__construct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 362 |
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `ps_currency` c
LEFT JOIN ps_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1 |
0.182
ms
|
1 |
|
|
/classes/Currency.php:1136
/classes/Currency.php:1153 (countActiveCurrencies)
/classes/module/Module.php:2227 (isMultiCurrencyActivated)
/modules/stminiatureattrimg/stminiatureattrimg.php:1021 (getCacheId)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 393 |
SELECT SQL_NO_CACHE * FROM `ps_cart_rule` cr
LEFT JOIN `ps_cart_rule_lang` crl
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%" |
0.182
ms
|
1 |
|
|
/classes/CartRule.php:423
/override/classes/CartRule.php:108 (getCustomerCartRules)
/override/classes/CartRule.php:153 (getCustomerCartRules)
/classes/Cart.php:522 (getCustomerHighlightedDiscounts)
/src/Adapter/Presenter/Cart/CartLazyArray.php:396 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 396 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "topWidth" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.182
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:390 (displayBlock)
/classes/Hook.php:1077 (hookDisplayAfterBodyOpeningTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:266 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:74 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 412 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayNav2" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.182
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:419 (displayBlock)
/classes/Hook.php:1077 (hookDisplayNav2)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:114 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 423 |
SELECT SQL_NO_CACHE DISTINCT(qdr.`id_quantity_discount_rule`)
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_lang` qdrl
ON (qdr.`id_quantity_discount_rule` = qdrl.`id_quantity_discount_rule` AND qdrl.`id_lang` = 5)
INNER JOIN `ps_quantity_discount_rule_message` qdrm
ON (qdrm.`id_quantity_discount_rule` = qdr.`id_quantity_discount_rule` AND qdrm.`hook_name` = 'hookDisplayTop')
INNER JOIN `ps_quantity_discount_rule_message_lang` qdrml
ON (qdrm.`id_quantity_discount_rule_message` = qdrml.`id_quantity_discount_rule_message` AND qdrml.`id_lang` = 5)
WHERE qdr.`active` = 1
AND qdr.`id_shop` = 1 AND `id_family` = 1
ORDER BY qdr.`priority` ASC, qdr.`id_quantity_discount_rule` ASC |
0.182
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:307
/modules/quantitydiscountpro/quantitydiscountpro.php:824 (getQuantityDiscountRulesByFamilyForMessages)
/modules/quantitydiscountpro/quantitydiscountpro.php:639 (getMessage)
/classes/Hook.php:1077 (hookDisplayTop)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:159 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 403 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayBanner" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.178
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:348 (displayBlock)
/classes/Hook.php:1077 (hookDisplayBanner)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:75 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:38 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 470 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1536 AND pa.`id_product` = 1536 AND pa.`id_product_attribute` = 1945 LIMIT 1 |
0.178
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 63 |
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 1536
AND DATEDIFF("2025-10-28 00:00:00", product_shop.`date_add`) < 200 LIMIT 1 |
0.177
ms
|
0 |
|
|
/classes/Product.php:1732
/classes/Product.php:743 (isNew)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 154 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1533) |
0.176
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 375 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayHeader" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.175
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:320 (displayBlock)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 406 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayNav1" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.170
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:414 (displayBlock)
/classes/Hook.php:1077 (hookDisplayNav1)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 376 |
SELECT SQL_NO_CACHE id_zone FROM `ps_country` AS tmpz WHERE tmpz.`iso_code` LIKE 'IT%' AND tmpz.`active` = 1 AND tmpz.id_zone > 0 GROUP BY tmpz.id_zone |
0.169
ms
|
1 |
Yes
|
Yes
|
/modules/estimateddelivery/estimateddelivery.php:3067
/modules/estimateddelivery/estimateddelivery.php:5568 (getIpCarriers)
/modules/estimateddelivery/estimateddelivery.php:5345 (getEDCarriers)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 6 |
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `ps_lang` l
LEFT JOIN `ps_lang_shop` ls ON (l.id_lang = ls.id_lang) |
0.167
ms
|
5 |
|
|
/classes/Language.php:1080
/config/config.inc.php:143 (loadLanguages)
/index.php:38 (require)
|
| 426 |
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 1536
AND DATEDIFF("2025-10-28 00:00:00", product_shop.`date_add`) < 200 LIMIT 1 |
0.167
ms
|
0 |
|
|
/classes/Product.php:1732
/classes/Product.php:743 (isNew)
/modules/omniversepricing/omniversepricing.php:1035 (__construct)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 463 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.166
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/modules/stripe_official/stripe_official.php:526 (outOfStock)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 66 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1536) |
0.164
ms
|
2 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 498 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.164
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 163 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1534) |
0.164
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 64 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1536 LIMIT 1 |
0.163
ms
|
2 |
|
|
/classes/Product.php:1106
/classes/Product.php:3817 (getDefaultAttribute)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 588 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 5
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 760) AND (b.`id_shop` = 1) LIMIT 1 |
0.163
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Category.php:164 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:39 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 7 |
SELECT SQL_NO_CACHE *
FROM `ps_country` a
LEFT JOIN `ps_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1 |
0.162
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/config/config.inc.php:146 (__construct)
/index.php:38 (require)
|
| 118 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1617 AND ctg.`id_group` = 1 LIMIT 1 |
0.162
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 251 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1824) |
0.162
ms
|
7 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 607 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayBeforeBodyClosingTag" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.161
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:403 (displayBlock)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 472 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1945) LIMIT 1 |
0.160
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 530 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.160
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 81 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1536 AND ctg.`id_group` = 1 LIMIT 1 |
0.159
ms
|
7 |
|
|
/classes/Product.php:6740
/classes/Product.php:6717 (checkAccessStatic)
/controllers/front/ProductController.php:265 (checkAccess)
/controllers/front/ProductController.php:167 (checkPermissionsToViewProduct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 126 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE product_attribute_shop.default_on = 1 AND pa.id_product = 1824 LIMIT 1 |
0.159
ms
|
7 |
|
|
/classes/Product.php:1121
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 219 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1617
AND image_shop.`cover` = 1 LIMIT 1 |
0.159
ms
|
4 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 374 |
SELECT SQL_NO_CACHE *
FROM `ps_whatsappchatblock_agent` LEFT JOIN `ps_whatsappchatblock_agent_lang` ON (`ps_whatsappchatblock_agent`.`id_whatsappchatblock_agent` = `ps_whatsappchatblock_agent_lang`.`id_whatsappchatblock_agent` AND `id_lang` = 5) WHERE 1 = 1 AND `active` = 1 ORDER BY position |
0.159
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlockAgent.php:78
/modules/whatsappchat/whatsappchat.php:311 (getWhatsappChatAgents)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 323 |
SELECT SQL_NO_CACHE id_simpleblog_post, id_product
FROM `ps_simpleblog_related_post`
WHERE (id_product = 1536) |
0.158
ms
|
1 |
|
|
/modules/ph_relatedposts/models/SimpleBlogRelatedPost.php:35
/modules/ph_relatedposts/ph_relatedposts.php:215 (getByProductId)
/modules/ph_relatedposts/ph_relatedposts.php:174 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 605 |
SELECT SQL_NO_CACHE *
FROM `ps_whatsappchatblock_agent` LEFT JOIN `ps_whatsappchatblock_agent_lang` ON (`ps_whatsappchatblock_agent`.`id_whatsappchatblock_agent` = `ps_whatsappchatblock_agent_lang`.`id_whatsappchatblock_agent` AND `id_lang` = 5) WHERE 1 = 1 AND `ps_whatsappchatblock_agent`.`id_whatsappchatblock` = 1 AND `active` = 1 ORDER BY position |
0.158
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlockAgent.php:78
/modules/whatsappchat/whatsappchat.php:679 (getWhatsappChatAgents)
/modules/whatsappchat/whatsappchat.php:400 (displayBlock)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 13 |
SELECT SQL_NO_CACHE domain, domain_ssl
FROM ps_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1 |
0.158
ms
|
1 |
|
|
/classes/shop/ShopUrl.php:182
/classes/shop/ShopUrl.php:198 (cacheMainDomainForShop)
/classes/Tools.php:302 (getMainShopDomain)
/classes/Link.php:65 (getShopDomain)
/config/config.inc.php:277 (__construct)
/index.php:38 (require)
|
| 35 |
SELECT SQL_NO_CACHE *
FROM `ps_country` a
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1 |
0.157
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/modules/pagecache/pagecache.php:4172 (__construct)
/modules/pagecache/pagecache.php:557 (getCountry)
/modules/pagecache/pagecache.php:1315 (init)
/classes/Hook.php:1077 (hookActionDispatcherBefore)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 231 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1821) |
0.157
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 222 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1617) |
0.156
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 89 |
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM ps_tag t
LEFT JOIN ps_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=1536 |
0.155
ms
|
1 |
|
|
/classes/Tag.php:244
/modules/klaviyopsautomation/classes/BusinessLogicServices/ProductPayloadService.php:278 (getProductTags)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:1038 (getProductTagsArray)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:995 (addViewedProductData)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:983 (setupViewedProduct)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:676 (setupProductEvents)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 204 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1540) |
0.155
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 397 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "topWidthSticky" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.155
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:391 (displayBlock)
/classes/Hook.php:1077 (hookDisplayAfterBodyOpeningTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:266 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:74 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 598 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 5
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 765) AND (b.`id_shop` = 1) LIMIT 1 |
0.155
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Category.php:164 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:39 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 85 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_accounts" LIMIT 1 |
0.154
ms
|
1 |
|
|
/src/Adapter/Module/ModuleDataProvider.php:257
/src/Adapter/Module/ModuleDataProvider.php:228 (getModuleIdByName)
/src/Core/Module/ModuleManager.php:329 (isInstalled)
/modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php:83 (isInstalled)
/modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php:44 (isModuleInstalled)
/modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php:62 (getService)
/modules/ps_checkout/src/Repository/PsAccountRepository.php:46 (getPsAccountsService)
/var/cache/prod/Ps_checkout8440FrontContainer.php:1149 (__construct)
/var/cache/prod/Ps_checkout8440FrontContainer.php:1239 (getPsAccountRepositoryService)
/var/cache/prod/Ps_checkout8440FrontContainer.php:1229 (getMerchantValidatorService)
/vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php:257 (getFrontControllerValidatorService)
/vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php:231 (make)
/modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php:64 (get)
/modules/ps_checkout/ps_checkout.php:1519 (getService)
/modules/ps_checkout/ps_checkout.php:913 (getService)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 267 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1825) |
0.154
ms
|
7 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 213 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1543) |
0.154
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 432 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.153
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/quantitydiscountpro.php:823 (getQuantityDiscountRuleFamilies)
/modules/quantitydiscountpro/quantitydiscountpro.php:714 (getMessage)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 114 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1540 AND ctg.`id_group` = 1 LIMIT 1 |
0.152
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 420 |
SELECT SQL_NO_CACHE cr.`id_cart_rule`
FROM `ps_cart_cart_rule` cd
LEFT JOIN `ps_cart_rule` cr ON cd.`id_cart_rule` = cr.`id_cart_rule`
LEFT JOIN `ps_cart_rule_lang` crl ON (
cd.`id_cart_rule` = crl.`id_cart_rule`
AND crl.id_lang = 5
)
WHERE `id_cart` = 0
AND free_shipping = 1
ORDER BY cr.priority ASC, cr.gift_product DESC |
0.152
ms
|
1 |
Yes
|
|
/classes/Cart.php:555
/modules/iqitfreedeliverycount/iqitfreedeliverycount.php:306 (getOrderedCartRulesIds)
/modules/iqitfreedeliverycount/iqitfreedeliverycount.php:245 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php:41 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b70ab2_17867096)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php:32 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b48ca4_33419761)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php:28 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b433a1_28967025)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:144 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 148 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1531) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.152
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 173 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1537) |
0.152
ms
|
2 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 502 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.152
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 445 |
SELECT SQL_NO_CACHE * FROM ps_ed_holidays h
LEFT JOIN ps_ed_holidays_shop hs ON (h.id_holidays = hs.id_holidays AND hs.id_shop = 1)
WHERE active = 1
ORDER BY holiday_start ASC |
0.151
ms
|
1 |
|
|
/modules/estimateddelivery/classes/DeliveryHelper.php:82
/modules/estimateddelivery/classes/DeliveryHelper.php:32 (getHolidays)
/modules/estimateddelivery/estimateddelivery.php:3442 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 509 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.150
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 113 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE product_attribute_shop.default_on = 1 AND pa.id_product = 1539 LIMIT 1 |
0.149
ms
|
2 |
|
|
/classes/Product.php:1121
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 241 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1822) |
0.149
ms
|
1 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 334 |
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 5)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 5)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 5)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1536
ORDER BY f.position ASC |
0.149
ms
|
1 |
Yes
|
|
/classes/Product.php:6021
/classes/Product.php:5824 (getFrontFeaturesStatic)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 93 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `ps_category` c
WHERE (c.`id_category` = 2) LIMIT 1 |
0.149
ms
|
1 |
|
|
/classes/Category.php:1974
/classes/Category.php:1998 (getInterval)
/controllers/front/ProductController.php:889 (inShop)
/controllers/front/ProductController.php:368 (assignCategory)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 128 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1825 LIMIT 1 |
0.148
ms
|
7 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 448 |
SELECT SQL_NO_CACHE depends_on_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.148
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:753
/modules/estimateddelivery/classes/DeliveryProduct.php:192 (dependsOnStock)
/modules/estimateddelivery/classes/DeliveryProduct.php:127 (populateStaticProductData)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 500 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.148
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 572 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.148
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:256 (getWidgetModels)
:undefined (displayFooter)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:62 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 189 |
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1539) |
0.148
ms
|
2 |
|
|
/classes/Product.php:3860
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 516 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.148
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 3 |
SELECT SQL_NO_CACHE value FROM `ps_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1 |
0.147
ms
|
1 |
|
|
/classes/shop/Shop.php:1183
/classes/Configuration.php:236 (isFeatureActive)
/classes/Configuration.php:302 (get)
/classes/shop/Shop.php:398 (getMultiShopValues)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 282 |
SELECT SQL_NO_CACHE * FROM `ps_image_type` WHERE 1 AND `products` = 1 ORDER BY `width` DESC, `height` DESC, `name`ASC |
0.147
ms
|
9 |
Yes
|
|
/classes/ImageType.php:109
/src/Adapter/Image/ImageRetriever.php:221 (getImagesTypes)
/src/Adapter/Image/ImageRetriever.php:111 (getImage)
:undefined (PrestaShop\PrestaShop\Adapter\Image\{closure})
/src/Adapter/Image/ImageRetriever.php:104 (array_map)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 488 |
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 1536
AND DATEDIFF("2025-10-28 00:00:00", product_shop.`date_add`) < 200 LIMIT 1 |
0.147
ms
|
0 |
|
|
/classes/Product.php:1732
/classes/Product.php:743 (isNew)
/modules/giftcard/giftcard.php:1036 (__construct)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 506 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.147
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 575 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.147
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/quantitydiscountpro.php:823 (getQuantityDiscountRuleFamilies)
/modules/quantitydiscountpro/quantitydiscountpro.php:469 (getMessage)
/classes/Hook.php:1077 (hookDisplayFooter)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:62 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 369 |
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.147
ms
|
0 |
|
|
/classes/tax/TaxRulesTaxManager.php:109
/classes/Product.php:3952 (getTaxCalculator)
/modules/fabfacebookpixel/libs/FFPUtils.php:266 (priceCalculation)
/modules/fabfacebookpixel/libs/FFPProductInfoTrait.php:153 (getProductPrice)
/modules/fabfacebookpixel/fabfacebookpixel.php:504 (fillAndReturnData)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 129 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE product_attribute_shop.default_on = 1 AND pa.id_product = 1825 LIMIT 1 |
0.146
ms
|
7 |
|
|
/classes/Product.php:1121
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 398 |
SELECT SQL_NO_CACHE * FROM `ps_whatsappchatblock` LEFT JOIN `ps_whatsappchatblock_lang` ON (`ps_whatsappchatblock`.`id_whatsappchatblock` = `ps_whatsappchatblock_lang`.`id_whatsappchatblock` AND `id_lang` = 5) WHERE `id_hook` = "hookDisplayAfterBodyOpeningTag" AND `id_shop` = 1 AND `active` = 1 ORDER BY position DESC; |
0.146
ms
|
1 |
Yes
|
|
/modules/whatsappchat/classes/WhatsappChatBlock.php:135
/modules/whatsappchat/whatsappchat.php:611 (getWhatsappChatByHook)
/modules/whatsappchat/whatsappchat.php:393 (displayBlock)
/classes/Hook.php:1077 (hookDisplayAfterBodyOpeningTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:266 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:74 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 100 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 685 AND ctg.`id_group` = 1 LIMIT 1 |
0.144
ms
|
16 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 443 |
SELECT SQL_NO_CACHE product_shop.`id_category_default`
FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.`id_product` = 1536 LIMIT 1 |
0.144
ms
|
1 |
|
|
/classes/Product.php:7925
/modules/estimateddelivery/estimateddelivery.php:3421 (getDefaultCategory)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 504 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.144
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 514 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.144
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 582 |
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 5)
WHERE `level_depth` = 1 |
0.144
ms
|
5 |
|
|
/classes/Category.php:2242
/classes/Category.php:1558 (getCategoriesWithoutParent)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 127 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1825 AND ctg.`id_group` = 1 LIMIT 1 |
0.143
ms
|
8 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 38 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "hoselectronicinvoice" LIMIT 1 |
0.142
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2107 (getModuleIdByName)
/override/classes/Address.php:36 (isInstalled)
/modules/thecheckout/classes/Config.php:85 (__construct)
/modules/thecheckout/classes/Config.php:183 (getAddressObjectCustomFields)
/modules/thecheckout/thecheckout.php:309 (__construct)
/modules/thecheckout/thecheckout.php:258 (setConfigOptions)
/modules/thecheckout/thecheckout.php:67 (initTheCheckout)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:507 (exec)
/index.php:39 (dispatch)
|
| 258 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1824 AND pa.`id_product` = 1824 AND pa.`id_product_attribute` = 2282 LIMIT 1 |
0.142
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 247 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1824
AND image_shop.`cover` = 1 LIMIT 1 |
0.141
ms
|
16 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 483 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.141
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/quantitydiscountpro.php:823 (getQuantityDiscountRuleFamilies)
/modules/quantitydiscountpro/quantitydiscountpro.php:655 (getMessage)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 80 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_product_shop`
WHERE `id_product` = 1536
AND id_shop = 1 LIMIT 1 |
0.141
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/controllers/front/ProductController.php:192 (isAssociatedToShop)
/controllers/front/ProductController.php:167 (checkPermissionsToViewProduct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 115 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1540 LIMIT 1 |
0.141
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 116 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1543 AND ctg.`id_group` = 1 LIMIT 1 |
0.141
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 120 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1821 AND ctg.`id_group` = 1 LIMIT 1 |
0.141
ms
|
8 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 277 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 2289) LIMIT 1 |
0.141
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 449 |
SELECT SQL_NO_CACHE delay AS oos_add_days, picking_days AS add_picking_days, customization_days AS add_custom_days, release_date, disabled FROM ps_ed_prod WHERE id_product = 1536 AND id_shop IN (1) LIMIT 1 |
0.141
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:220
/modules/estimateddelivery/classes/DeliveryProduct.php:199 (loadProductData)
/modules/estimateddelivery/classes/DeliveryProduct.php:127 (populateStaticProductData)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 577 |
SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_content c WHERE c.active = 1 AND c.hook = 896 |
0.140
ms
|
6 |
|
|
/modules/iqitelementor/src/IqitElementorContent.php:127
/modules/iqitelementor/iqitelementor.php:717 (getByHook)
/modules/iqitelementor/iqitelementor.php:593 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:124 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:68 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 11 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "pagecache" LIMIT 1 |
0.139
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/config/smartyfront.config.inc.php:58 (isEnabled)
/config/smarty.config.inc.php:59 (require_once)
/config/config.inc.php:245 (require_once)
/index.php:38 (require)
|
| 124 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1824 AND ctg.`id_group` = 1 LIMIT 1 |
0.138
ms
|
8 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 180 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1537 AND pa.`id_product` = 1537 AND pa.`id_product_attribute` = 1948 LIMIT 1 |
0.138
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 274 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1825 AND pa.`id_product` = 1825 AND pa.`id_product_attribute` = 2289 LIMIT 1 |
0.138
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 489 |
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM ps_tag t
LEFT JOIN ps_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=1536 |
0.138
ms
|
1 |
|
|
/classes/Tag.php:244
/classes/Product.php:749 (getProductTags)
/modules/giftcard/giftcard.php:1036 (__construct)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 570 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_emailsubscription" LIMIT 1 |
0.138
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/config/smartyfront.config.inc.php:91 (coreRenderWidget)
/config/smartyfront.config.inc.php:84 ({closure})
/config/smartyfront.config.inc.php:95 (withWidget)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyWidget)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:42 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 479 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.138
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/modules/stripe_official/stripe_official.php:1115 (outOfStock)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/modules/stripe_official/stripe_official.php:541 (exec)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 122 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1822 AND ctg.`id_group` = 1 LIMIT 1 |
0.137
ms
|
8 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 427 |
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM ps_tag t
LEFT JOIN ps_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=1536 |
0.137
ms
|
1 |
|
|
/classes/Tag.php:244
/classes/Product.php:749 (getProductTags)
/modules/omniversepricing/omniversepricing.php:1035 (__construct)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 522 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.137
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 518 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.137
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 70 |
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM ps_tag t
LEFT JOIN ps_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=1536 |
0.136
ms
|
1 |
|
|
/classes/Tag.php:244
/classes/Product.php:749 (getProductTags)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 196 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1539 AND pa.`id_product` = 1539 AND pa.`id_product_attribute` = 1951 LIMIT 1 |
0.136
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 121 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1821 LIMIT 1 |
0.135
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 123 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1822 LIMIT 1 |
0.135
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 119 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1617 LIMIT 1 |
0.134
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 315 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitadditionaltabs" LIMIT 1 |
0.134
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 485 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.134
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:112 (getWidgetModels)
:undefined (displayProductAdditionalInfo)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 117 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1543 LIMIT 1 |
0.133
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 261 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 2282) LIMIT 1 |
0.133
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 286 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1533 |
0.133
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 363 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "onepagecheckoutps" LIMIT 1 |
0.133
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/modules/rcpgtagmanager/src/PSModule/ModuleDetector/AbstractModuleDetector.php:70 (isEnabled)
/modules/rcpgtagmanager/src/PSModule/ModuleDetector/AbstractModuleDetector.php:39 (detectByController)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:170 (getCheckoutModule)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:159 (getCheckoutModule)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:66 (getModuleData)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:54 (setContextData)
/modules/rcpgtagmanager/src/PSModule/ModuleServiceFactoryPS8.php:78 (__construct)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayHeader/AbstractDisplayHeader.php:57 (getContextService)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayHeader/AbstractDisplayHeader.php:39 (getConfiguration)
/modules/rcpgtagmanager/rcpgtagmanager.php:197 (exec)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 288 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1534 |
0.133
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 83 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "pm_advancedpack" LIMIT 1 |
0.132
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/modules/estimateddelivery/estimateddelivery.php:5411 (isEnabled)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 466 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1945 LIMIT 1 |
0.132
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 90 |
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 208)
AND ('42021' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '42021')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.132
ms
|
0 |
|
|
/classes/tax/TaxRulesTaxManager.php:109
/classes/Product.php:3952 (getTaxCalculator)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:4168 (getPriceStatic)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:1040 (getPrice)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:995 (addViewedProductData)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:983 (setupViewedProduct)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:676 (setupProductEvents)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 263 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1825
AND image_shop.`cover` = 1 LIMIT 1 |
0.131
ms
|
14 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 346 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_legalcompliance" LIMIT 1 |
0.131
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/controller/FrontController.php:1669 (isEnabled)
/classes/controller/FrontController.php:1813 (getDisplayTaxesLabel)
/controllers/front/ProductController.php:1462 (getTemplateVarPage)
/classes/controller/FrontController.php:562 (getTemplateVarPage)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 45 |
SELECT SQL_NO_CACHE *
FROM `ps_currency` a
LEFT JOIN `ps_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 5
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1 |
0.131
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Currency.php:246 (__construct)
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct)
/src/Adapter/Currency/CurrencyDataProvider.php:114 (getCurrencyByIsoCode)
/src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php:102 (getCurrencyByIsoCodeAndLocale)
/src/Core/Data/Layer/AbstractDataLayer.php:91 (doRead)
/src/Core/Data/Layer/AbstractDataLayer.php:150 (read)
/src/Core/Data/Layer/AbstractDataLayer.php:95 (propagateRead)
/src/Core/Localization/Currency/CurrencyDataSource.php:67 (read)
/src/Core/Localization/Currency/CurrencyDataSource.php:109 (getLocalizedCurrencyData)
/src/Core/Localization/Currency/CurrencyDataSource.php:96 (formatCurrenciesData)
/src/Core/Localization/Currency/Repository.php:87 (getAllInstalledCurrenciesData)
/src/Core/Localization/Locale/Repository.php:207 (getAllInstalledCurrencies)
/src/Core/Localization/Locale/Repository.php:150 (getPriceSpecifications)
/classes/controller/Controller.php:209 (getLocale)
/classes/controller/FrontController.php:284 (init)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 65 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE product_attribute_shop.default_on = 1 AND pa.id_product = 1536 LIMIT 1 |
0.131
ms
|
2 |
|
|
/classes/Product.php:1121
/classes/Product.php:3817 (getDefaultAttribute)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 578 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitsociallogin" LIMIT 1 |
0.130
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php:48 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313f12d74_59860912)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitwishlist/iqitwishlist.php:212 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 5 |
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM ps_shop s
LEFT JOIN ps_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1 |
0.130
ms
|
1 |
|
|
/classes/shop/Shop.php:218
/classes/shop/Shop.php:148 (setUrl)
/classes/shop/Shop.php:431 (__construct)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 520 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.130
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 137 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 685) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.129
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 199 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1951) LIMIT 1 |
0.129
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 280 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 685 |
0.129
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 451 |
SELECT SQL_NO_CACHE weight FROM ps_product_attribute WHERE id_product_attribute = 1946 LIMIT 1 |
0.129
ms
|
1 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:615
/modules/estimateddelivery/classes/DeliveryProduct.php:272 (setCombinationWeight)
/modules/estimateddelivery/classes/DeliveryProduct.php:131 (loadCombinationData)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 496 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.129
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/modules/stripe_official/stripe_official.php:1115 (outOfStock)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:101 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/db/57/f9db5799651b3f378c9428b7cf5e61d88b0af391_2.file.product-add-to-cart.tpl.php:32 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c315415fe6_66995437)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:483 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:549 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 293 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1539 |
0.128
ms
|
2 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 361 |
SELECT SQL_NO_CACHE * FROM ps_revslider_sliders |
0.128
ms
|
1 |
|
|
/modules/revsliderprestashop/includes/revslider_db.class.php:214
/modules/revsliderprestashop/revsliderprestashop.php:578 (getResults)
/modules/revsliderprestashop/revsliderprestashop.php:330 (hookCommonCb)
/classes/Hook.php:1077 (hookdisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 408 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_currencyselector" LIMIT 1 |
0.128
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:114 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 468 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 1945) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.128
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 564 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.128
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 61 |
SELECT SQL_NO_CACHE *
FROM `ps_tax` a
WHERE (a.`id_tax` = 78) LIMIT 1 |
0.128
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/tax/TaxRulesTaxManager.php:116 (__construct)
/classes/Product.php:6899 (getTaxCalculator)
/classes/Product.php:741 (getTaxesRate)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 23 |
SELECT SQL_NO_CACHE name, alias FROM `ps_hook_alias` |
0.127
ms
|
87 |
|
|
/classes/Hook.php:339
/classes/Hook.php:154 (getCanonicalHookNames)
/classes/Hook.php:363 (normalizeHookName)
/classes/Hook.php:386 (getAllKnownNames)
/classes/Hook.php:974 (isHookCallableOn)
/classes/Dispatcher.php:606 (exec)
/classes/Dispatcher.php:243 (loadRoutes)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 36 |
SELECT SQL_NO_CACHE *
FROM `ps_country_lang`
WHERE `id_country` = 10 |
0.127
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/modules/pagecache/pagecache.php:4172 (__construct)
/modules/pagecache/pagecache.php:557 (getCountry)
/modules/pagecache/pagecache.php:1315 (init)
/classes/Hook.php:1077 (hookActionDispatcherBefore)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 62 |
SELECT SQL_NO_CACHE *
FROM `ps_tax_lang`
WHERE `id_tax` = 78 |
0.127
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/tax/TaxRulesTaxManager.php:116 (__construct)
/classes/Product.php:6899 (getTaxCalculator)
/classes/Product.php:741 (getTaxesRate)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 183 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1948) LIMIT 1 |
0.127
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 387 |
SELECT SQL_NO_CACHE id_category FROM ps_category_product WHERE id_product = 1536 |
0.127
ms
|
7 |
|
|
/override/controllers/front/ProductController.php:9
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 284 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1531 |
0.127
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 309 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1825 |
0.126
ms
|
7 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 560 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.126
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 94 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_category_shop`
WHERE `id_category` = 499
AND id_shop = 1 LIMIT 1 |
0.125
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/controllers/front/ProductController.php:889 (isAssociatedToShop)
/controllers/front/ProductController.php:368 (assignCategory)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 9 |
SELECT SQL_NO_CACHE *
FROM `ps_lang` a
LEFT JOIN `ps_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1 |
0.125
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/config/config.inc.php:211 (__construct)
/index.php:38 (require)
|
| 300 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1617 |
0.125
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 342 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1536 |
0.124
ms
|
2 |
|
|
/classes/Product.php:2902
/controllers/front/ProductController.php:646 (getCombinationImages)
/controllers/front/ProductController.php:462 (assignAttributesGroups)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 440 |
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM ps_tag t
LEFT JOIN ps_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=1536 |
0.124
ms
|
1 |
|
|
/classes/Tag.php:244
/modules/iqitproducttags/iqitproducttags.php:89 (getProductTags)
/modules/iqitproducttags/iqitproducttags.php:78 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 42 |
SELECT SQL_NO_CACHE * FROM `ps_currency` c ORDER BY `iso_code` ASC |
0.123
ms
|
1 |
Yes
|
|
/classes/Currency.php:709
/src/Adapter/Currency/CurrencyDataProvider.php:84 (findAllInstalled)
/src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php:90 (findAllInstalled)
/src/Core/Localization/Currency/CurrencyDataSource.php:96 (getAllInstalledCurrencyIsoCodes)
/src/Core/Localization/Currency/Repository.php:87 (getAllInstalledCurrenciesData)
/src/Core/Localization/Locale/Repository.php:207 (getAllInstalledCurrencies)
/src/Core/Localization/Locale/Repository.php:150 (getPriceSpecifications)
/classes/controller/Controller.php:209 (getLocale)
/classes/controller/FrontController.php:284 (init)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 290 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1537 |
0.123
ms
|
2 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 465 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 499 LIMIT 1 |
0.123
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 40 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "xps_checkout" LIMIT 1 |
0.122
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2107 (getModuleIdByName)
/modules/thecheckout/classes/Config.php:160 (isInstalled)
/modules/thecheckout/thecheckout.php:309 (__construct)
/modules/thecheckout/thecheckout.php:258 (setConfigOptions)
/modules/thecheckout/thecheckout.php:67 (initTheCheckout)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:507 (exec)
/index.php:39 (dispatch)
|
| 216 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.122
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 438 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitproducttags" LIMIT 1 |
0.122
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 475 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1536 |
0.122
ms
|
2 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:55 (present)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:64 (createProductLazyArrayFromArray)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 542 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitcrossselling" LIMIT 1 |
0.122
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 562 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.122
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 57 |
SELECT SQL_NO_CACHE `name` FROM `ps_supplier` WHERE `id_supplier` = 0 LIMIT 1 |
0.122
ms
|
0 |
|
|
/classes/Supplier.php:243
/classes/Product.php:735 (getNameById)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 539 |
SELECT SQL_NO_CACHE id_absfreqbought FROM `ps_absfreqbought` WHERE id_product=1536 |
0.121
ms
|
1 |
|
|
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:943
/modules/absfrequentlyboughttogether/class/AbsBuyItWith.php:1582 (getIdAbsFreqBought)
/modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php:737 (createList)
/classes/Hook.php:1077 (hookdisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 32 |
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1 |
0.121
ms
|
2 |
|
|
/modules/ps_mbo/ps_mbo.php:335
/modules/ps_mbo/ps_mbo.php:118 (checkModuleStatus)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 324 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.121
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:147 (getWidgetModels)
:undefined (displayProductExtraContent)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 417 |
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `ps_cart_product`
WHERE `id_cart` = 0 LIMIT 1 |
0.121
ms
|
1 |
|
|
/classes/Cart.php:1303
/src/Adapter/Presenter/Cart/CartLazyArray.php:300 (getNbProducts)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getProductsCount)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php:29 (offsetGet)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b48ca4_33419761)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php:28 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b433a1_28967025)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:144 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 296 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1540 |
0.120
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 29 |
SELECT SQL_NO_CACHE * FROM `ps_hook_module_exceptions`
WHERE `id_shop` IN (1) |
0.120
ms
|
4 |
|
|
/classes/module/Module.php:2041
/classes/Hook.php:929 (getExceptionsStatic)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 34 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "bvkseodispatcher" LIMIT 1 |
0.119
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2107 (getModuleIdByName)
/modules/pagecache/pagecache.php:206 (isInstalled)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 86 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "swiftcheckout" LIMIT 1 |
0.119
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/modules/codfee/codfee.php:331 (isEnabled)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 298 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1543 |
0.119
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 473 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1945 |
0.118
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/ProductAssembler.php:187 (getProductProperties)
/modules/stripe_official/classes/factories/StripeProductLazyArrayFactory.php:62 (assembleProduct)
/modules/stripe_official/stripe_official.php:536 (createProductLazyArrayFromProductId)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 16 |
SELECT SQL_NO_CACHE *
FROM `ps_lang` a
LEFT JOIN `ps_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 5) LIMIT 1 |
0.118
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Tools.php:641 (__construct)
/classes/Dispatcher.php:236 (switchLanguage)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 105 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1533 LIMIT 1 |
0.117
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 381 |
SELECT SQL_NO_CACHE qdr.`id_quantity_discount_rule`, qdrc.`id_quantity_discount_rule_condition`
FROM `ps_quantity_discount_rule` qdr
INNER JOIN `ps_quantity_discount_rule_condition` qdrc ON (qdr.`id_quantity_discount_rule` = qdrc.`id_quantity_discount_rule`)
WHERE qdrc.`id_type` = 27 AND qdr.`id_shop` = 1 |
0.117
ms
|
6 |
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:276
/modules/quantitydiscountpro/quantitydiscountpro.php:442 (getQuantityDiscountRulesWithCondition)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 39 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 107 AND `id_shop` = 1 LIMIT 1 |
0.117
ms
|
1 |
|
|
/classes/module/Module.php:2132
/override/classes/Address.php:36 (isEnabled)
/modules/thecheckout/classes/Config.php:85 (__construct)
/modules/thecheckout/classes/Config.php:183 (getAddressObjectCustomFields)
/modules/thecheckout/thecheckout.php:309 (__construct)
/modules/thecheckout/thecheckout.php:258 (setConfigOptions)
/modules/thecheckout/thecheckout.php:67 (initTheCheckout)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:507 (exec)
/index.php:39 (dispatch)
|
| 307 |
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (2282, 2283, 2284, 2285, 2286, 2287, 2288) AND il.`id_lang` = 5 ORDER by i.`position` |
0.117
ms
|
7 |
Yes
|
|
/classes/Product.php:2921
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 567 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.117
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/quantitydiscountpro.php:823 (getQuantityDiscountRuleFamilies)
/modules/quantitydiscountpro/quantitydiscountpro.php:670 (getMessage)
/classes/Hook.php:1077 (hookDisplayFooterProduct)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 456 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.116
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/modules/estimateddelivery/classes/DeliveryProduct.php:628 (outOfStock)
/modules/estimateddelivery/classes/DeliveryProduct.php:173 (setCanOOS)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 353 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 3
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.115
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 327 |
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1536
AND image_shop.`cover` = 1 LIMIT 1 |
0.114
ms
|
7 |
|
|
/classes/Product.php:3570
/classes/Product.php:5643 (getCover)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 356 |
SELECT SQL_NO_CACHE format
FROM `ps_address_format`
WHERE `id_country` = 10 LIMIT 1 |
0.114
ms
|
1 |
|
|
/classes/AddressFormat.php:656
/classes/AddressFormat.php:630 (getFormatDB)
/classes/AddressFormat.php:615 (getFormat)
/classes/AddressFormat.php:562 (getAddressCountryFormat)
/classes/AddressFormat.php:438 (getOrderedAddressFields)
/classes/controller/FrontController.php:1773 (generateAddress)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 486 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.114
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:128 (getWidgetModels)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:116 (displayProductNameInfos)
:undefined (displayProductAdditionalInfo)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 31 |
SELECT SQL_NO_CACHE `active`
FROM `ps_module`
WHERE `name` = "ps_mbo" LIMIT 1 |
0.113
ms
|
1 |
|
|
/modules/ps_mbo/ps_mbo.php:325
/modules/ps_mbo/ps_mbo.php:118 (checkModuleStatus)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:351 (exec)
/index.php:39 (dispatch)
|
| 112 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1539 LIMIT 1 |
0.113
ms
|
2 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 355 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 4
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.113
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 394 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.113
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/classes/QuantityDiscountRule.php:365 (getQuantityDiscountRuleFamilies)
/override/classes/CartRule.php:114 (getHighlightedQuantityDiscountRules)
/override/classes/CartRule.php:153 (getCustomerCartRules)
/classes/Cart.php:522 (getCustomerHighlightedDiscounts)
/src/Adapter/Presenter/Cart/CartLazyArray.php:396 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:269 (getDiscounts)
/src/Adapter/Presenter/AbstractLazyArray.php:129 (offsetGet)
:undefined (jsonSerialize)
/classes/Smarty/SmartyLazyRegister.php:81 (json_encode)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/19/d0/9319d0dc60a2132e98c86ffd82f46871ef137d1f_2.file.javascript.tpl.php:65 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133faae5_03418854)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:587 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1a/d1/00/1ad1006e014a2eb0d96443884343ab2e9351e740_2.file.head.tpl.php:115 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133d68d8_77420010)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:226 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:232 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:181 (callParent)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 8 |
SELECT SQL_NO_CACHE *
FROM `ps_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1 |
0.112
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/shop/Shop.php:561 (__construct)
/config/config.inc.php:171 (getGroup)
/index.php:38 (require)
|
| 41 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "xbraintreeofficial" LIMIT 1 |
0.112
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2107 (getModuleIdByName)
/modules/thecheckout/classes/Config.php:160 (isInstalled)
/modules/thecheckout/thecheckout.php:309 (__construct)
/modules/thecheckout/thecheckout.php:258 (setConfigOptions)
/modules/thecheckout/thecheckout.php:67 (initTheCheckout)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/classes/Dispatcher.php:507 (exec)
/index.php:39 (dispatch)
|
| 583 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 5
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1 |
0.112
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Category.php:164 (__construct)
/classes/Category.php:1118 (__construct)
/classes/Category.php:1574 (getRootCategory)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 71 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.112
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:7866 (getQuantityAvailableByProduct)
/classes/Product.php:751 (loadStockData)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 109 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1537 LIMIT 1 |
0.112
ms
|
2 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 422 |
SELECT SQL_NO_CACHE qdrf.*
FROM `ps_quantity_discount_rule_family` qdrf
WHERE 1
AND qdrf.active = 1 AND qdrf.`id_shop` = 1 ORDER BY qdrf.priority ASC; |
0.112
ms
|
1 |
Yes
|
|
/modules/quantitydiscountpro/classes/QuantityDiscountRuleFamily.php:75
/modules/quantitydiscountpro/quantitydiscountpro.php:823 (getQuantityDiscountRuleFamilies)
/modules/quantitydiscountpro/quantitydiscountpro.php:639 (getMessage)
/classes/Hook.php:1077 (hookDisplayTop)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:159 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 351 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.111
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/classes/Link.php:113 (__construct)
/classes/Link.php:185 (getProductObject)
/classes/Link.php:1215 (getProductLink)
/classes/controller/FrontController.php:2180 (getLanguageLink)
/classes/controller/FrontController.php:1620 (getAlternativeLangsUrl)
/classes/controller/FrontController.php:1753 (getTemplateVarUrls)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 142 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 5
AND cl.id_shop = 1
AND cl.`id_category` = 746 LIMIT 1 |
0.111
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:5658 (getLinkRewrite)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 490 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.110
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/classes/Product.php:7867 (outOfStock)
/classes/Product.php:751 (loadStockData)
/modules/giftcard/giftcard.php:1036 (__construct)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 592 |
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 5
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 746) AND (b.`id_shop` = 1) LIMIT 1 |
0.110
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Category.php:164 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:39 (__construct)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 101 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 685 LIMIT 1 |
0.110
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 108 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1537 AND ctg.`id_group` = 1 LIMIT 1 |
0.109
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 4 |
SELECT SQL_NO_CACHE *
FROM `ps_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1 |
0.109
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/shop/Shop.php:145 (__construct)
/classes/shop/Shop.php:431 (__construct)
/config/config.inc.php:117 (initialize)
/index.php:38 (require)
|
| 131 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 5
AND cl.id_shop = 1
AND cl.`id_category` = 760 LIMIT 1 |
0.109
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:5658 (getLinkRewrite)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 480 |
SELECT SQL_NO_CACHE `iso_code`
FROM `ps_country`
WHERE `id_country` = 0 LIMIT 1 |
0.109
ms
|
0 |
|
|
/classes/Country.php:275
/modules/stripe_official/classes/model/AddressModel.php:45 (getIsoById)
/modules/stripe_official/classes/model/CustomerModel.php:49 (getFromContext)
/modules/stripe_official/stripe_official.php:1127 (getFromContext)
/classes/Hook.php:1077 (hookDisplayProductActions)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/modules/stripe_official/stripe_official.php:541 (exec)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 12 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1 |
0.108
ms
|
1 |
|
|
/classes/module/Module.php:2132
/config/smartyfront.config.inc.php:58 (isEnabled)
/config/smarty.config.inc.php:59 (require_once)
/config/config.inc.php:245 (require_once)
/index.php:38 (require)
|
| 104 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1533 AND ctg.`id_group` = 1 LIMIT 1 |
0.108
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 571 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1 |
0.108
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/config/smartyfront.config.inc.php:91 (coreRenderWidget)
/config/smartyfront.config.inc.php:84 ({closure})
/config/smartyfront.config.inc.php:95 (withWidget)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyWidget)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/33/4a/99/334a9937838e9ba719741af6338b8ea9b63c2e16_2.file.footer-3.tpl.php:42 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313daf585_17211259)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/5d/11/54/5d11542a4b88e75d89417f86a97391b7e6b139a1_2.file.footer.tpl.php:36 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313da6c45_13246469)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:538 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:154 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 373 |
SELECT SQL_NO_CACHE *
FROM `ps_group` a
LEFT JOIN `ps_group_lang` `b` ON a.`id_group` = b.`id_group` AND b.`id_lang` = 1
LEFT JOIN `ps_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1 |
0.107
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Group.php:81 (__construct)
/modules/fabfacebookpixel/libs/FFPUtils.php:308 (__construct)
/modules/fabfacebookpixel/libs/FFPUtils.php:317 (getCustomerGroups)
/modules/fabfacebookpixel/fabfacebookpixel.php:676 (getCustomerGroupsString)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 453 |
SELECT SQL_NO_CACHE customization_days AS add_custom_days FROM ps_ed_cat WHERE id_category = 499 AND id_shop IN (1) LIMIT 1 |
0.107
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:823
/modules/estimateddelivery/classes/DeliveryProduct.php:911 (getCatAdditional)
/modules/estimateddelivery/classes/DeliveryProduct.php:732 (getCatCustom)
/modules/estimateddelivery/classes/DeliveryProduct.php:152 (getProductAdditionalDays)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 608 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.107
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:100 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:280 (getTrustbadge)
:undefined (displayTrustbadge)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:208 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 135 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 685 AND id_shop=1 LIMIT 1 |
0.106
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 548 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1821 |
0.106
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 358 |
SELECT SQL_NO_CACHE *
FROM `ps_state` a
WHERE (a.`id_state` = 208) LIMIT 1 |
0.106
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/AddressFormat.php:404 (__construct)
/classes/AddressFormat.php:439 (getFormattedAddressFieldsValues)
/classes/controller/FrontController.php:1773 (generateAddress)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 15 |
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang` WHERE `iso_code` = 'fr' LIMIT 1 |
0.105
ms
|
5 |
|
|
/classes/Language.php:854
/classes/Tools.php:627 (getIdByIso)
/classes/Dispatcher.php:236 (switchLanguage)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 110 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE product_attribute_shop.default_on = 1 AND pa.id_product = 1537 LIMIT 1 |
0.105
ms
|
2 |
|
|
/classes/Product.php:1121
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 152 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.105
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 164 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1534 AND id_shop=1 LIMIT 1 |
0.105
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 424 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitextendedproduct" LIMIT 1 |
0.105
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/8f/d6/9a/8fd69a4f53cf2f3e384b1d901d7d353982efa142_2.file.product-thumbnails.tpl.php:49 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/8f/d6/9a/8fd69a4f53cf2f3e384b1d901d7d353982efa142_2.file.product-thumbnails.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3151f02e3_54237143)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/0c/26/39/0c2639e8d6890977b6d7e1fa2271d68dea188e17_2.file.product-cover-thumbnails.tpl.php:37 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3151e0d76_82435627)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:163 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:202 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:248 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:955 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 106 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1534 AND ctg.`id_group` = 1 LIMIT 1 |
0.104
ms
|
5 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 428 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.104
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/classes/Product.php:7867 (outOfStock)
/classes/Product.php:751 (loadStockData)
/modules/omniversepricing/omniversepricing.php:1035 (__construct)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 436 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitsizecharts" LIMIT 1 |
0.104
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:404 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:525 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 558 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.104
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e5fd89_62415358)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314e4e818_03680064)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechild/e9/dd/94/e9dd94f97a77aa129d38521b092ab1fb8898f011_2.module.iqitcrosssellingviewstemplateshookother.tpl.php:58 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31564dcd9_29276135)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitcrossselling/iqitcrossselling.php:253 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 102 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1531 AND ctg.`id_group` = 1 LIMIT 1 |
0.103
ms
|
5 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 166 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.103
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 345 |
SELECT SQL_NO_CACHE `id_zone`
FROM `ps_country`
WHERE `id_country` = 10 LIMIT 1 |
0.103
ms
|
1 |
|
|
/classes/Country.php:224
/modules/prestaminimumorderamount/classes/PrestaMinimumOrderRule.php:153 (getIdZone)
/modules/prestaminimumorderamount/prestaminimumorderamount.php:57 (getMinimumOrderAmount)
/classes/Hook.php:1077 (hookActionPresentCart)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/src/Adapter/Presenter/Cart/CartPresenter.php:213 (exec)
/classes/controller/FrontController.php:557 (present)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 416 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.103
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:230 (getWidgetModels)
:undefined (displayNav1)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:91 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 452 |
SELECT SQL_NO_CACHE * FROM ps_ed_prod_combi WHERE id_product = 1536 AND id_product_attribute = 1946 AND id_shop IN (1) LIMIT 1 |
0.103
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:352
/modules/estimateddelivery/classes/DeliveryProduct.php:330 (fetchCombinationDataFromDatabase)
/modules/estimateddelivery/classes/DeliveryProduct.php:279 (getEDCombinationData)
/modules/estimateddelivery/classes/DeliveryProduct.php:131 (loadCombinationData)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 386 |
SELECT SQL_NO_CACHE `name`
FROM `ps_hook`
WHERE `id_hook` = 1132 LIMIT 1 |
0.102
ms
|
1 |
|
|
/classes/Hook.php:244
/classes/Hook.php:911 (getNameById)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 407 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.102
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:230 (getWidgetModels)
:undefined (displayNav1)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 512 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.102
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:191 (getWidgetModels)
:undefined (displayProductListReviews)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:314 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f1/e3/fc/f1e3fc263570f6f0b869ff4314d6ce776ceb7944_2.file.product-miniature-1.tpl.php:34 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c1b077_36779727)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:71 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f9/85/ba/f985baf5d9a71bbc82970ae58850702117a3d60c_2.file.product.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313c0b6d2_91293088)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:384 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:734 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1047 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 382 |
SELECT SQL_NO_CACHE id_trustedshops_channel
FROM `ps_trustedshops_channel`
WHERE (id_client = 'ee144e624e46__PrestaShop') AND (id_lang = 5) AND (id_shop = 1) LIMIT 1 |
0.102
ms
|
9 |
|
|
/modules/trustedshopseasyintegration/src/Repository/ChannelRepository.php:99
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:707 (getChannelByClientIdLangShop)
/modules/trustedshopseasyintegration/src/Service/HookService.php:129 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookCommon.php:88 (getWidgetScriptLink)
:undefined (displayHeader)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 146 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1531 AND id_shop=1 LIMIT 1 |
0.101
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 256 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1824) AND (id_product_attribute = 2282) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.101
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 455 |
SELECT SQL_NO_CACHE delay AS oos_add_days FROM ps_ed_cat WHERE id_category = 499 AND id_shop IN (1) LIMIT 1 |
0.101
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:823
/modules/estimateddelivery/classes/DeliveryProduct.php:901 (getCatAdditional)
/modules/estimateddelivery/classes/DeliveryProduct.php:732 (getCatOOS)
/modules/estimateddelivery/classes/DeliveryProduct.php:152 (getProductAdditionalDays)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 333 |
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1536 AND pa.`id_product` = 1536 AND pa.`id_product_attribute` = 1946 LIMIT 1 |
0.101
ms
|
1 |
|
|
/classes/Product.php:1209
/classes/Product.php:5818 (getAvailableDate)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 493 |
SELECT SQL_NO_CACHE card_value, value_type
FROM `ps_gift_card`
Where id_product = 1536
ORDER BY id_product LIMIT 1 |
0.101
ms
|
4 |
|
|
/modules/giftcard/models/Gift.php:616
/modules/giftcard/giftcard.php:1044 (getCardValue)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 111 |
SELECT SQL_NO_CACHE ctg.`id_group`
FROM `ps_category_product` cp
INNER JOIN `ps_category_group` ctg ON (ctg.`id_category` = cp.`id_category`)
WHERE cp.`id_product` = 1539 AND ctg.`id_group` = 1 LIMIT 1 |
0.099
ms
|
4 |
|
|
/classes/Product.php:6740
/classes/Product.php:4707 (checkAccessStatic)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 557 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1543 |
0.099
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 103 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1531 LIMIT 1 |
0.099
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 434 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitcountdown" LIMIT 1 |
0.099
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:88 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 47 |
SELECT SQL_NO_CACHE *
FROM `ps_currency` a
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1 |
0.098
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Currency.php:246 (__construct)
/classes/Currency.php:1089 (__construct)
/classes/Tools.php:690 (getCurrencyInstance)
/classes/controller/FrontController.php:368 (setCurrency)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 107 |
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1534 LIMIT 1 |
0.098
ms
|
1 |
|
|
/classes/Product.php:1106
/classes/Product.php:4712 (getDefaultAttribute)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 178 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1537) AND (id_product_attribute = 1948) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.098
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 347 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.098
ms
|
0 |
|
|
/classes/module/Module.php:2132
/classes/controller/FrontController.php:1669 (isEnabled)
/classes/controller/FrontController.php:1813 (getDisplayTaxesLabel)
/controllers/front/ProductController.php:1462 (getTemplateVarPage)
/classes/controller/FrontController.php:562 (getTemplateVarPage)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 399 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitelementor" LIMIT 1 |
0.098
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:75 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:38 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 413 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitmegamenu" LIMIT 1 |
0.098
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 554 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1531 |
0.098
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 599 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`id_category` = 765 LIMIT 1 |
0.098
ms
|
1 |
|
|
/classes/Category.php:1585
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 316 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 68 AND `id_shop` = 1 LIMIT 1 |
0.097
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 377 |
SELECT SQL_NO_CACHE id_country FROM ps_country WHERE iso_code LIKE "IT" LIMIT 1 |
0.097
ms
|
1 |
|
|
/modules/estimateddelivery/estimateddelivery.php:4647
/modules/estimateddelivery/estimateddelivery.php:3074 (getIDCountryFromISO)
/modules/estimateddelivery/estimateddelivery.php:5568 (getIpCarriers)
/modules/estimateddelivery/estimateddelivery.php:5345 (getEDCarriers)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 491 |
SELECT SQL_NO_CACHE depends_on_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.097
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:753
/classes/Product.php:7868 (dependsOnStock)
/classes/Product.php:751 (loadStockData)
/modules/giftcard/giftcard.php:1036 (__construct)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 584 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`id_category` = 499 LIMIT 1 |
0.097
ms
|
1 |
|
|
/classes/Category.php:1585
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 194 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1539) AND (id_product_attribute = 1951) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.097
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 172 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1948 LIMIT 1 |
0.096
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 272 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1825) AND (id_product_attribute = 2289) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.096
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 302 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1821 |
0.096
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 409 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1 |
0.095
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:114 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 370 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.095
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/modules/fabfacebookpixel/libs/FFPProductInfoTrait.php:163 (outOfStock)
/modules/fabfacebookpixel/fabfacebookpixel.php:504 (fillAndReturnData)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 371 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 1946) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.095
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/modules/fabfacebookpixel/libs/FFPProductInfoTrait.php:170 (getQuantityAvailableByProduct)
/modules/fabfacebookpixel/fabfacebookpixel.php:504 (fillAndReturnData)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 379 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "bestkit_opc" LIMIT 1 |
0.095
ms
|
0 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/modules/codfee/codfee.php:347 (isEnabled)
/modules/codfee/codfee.php:339 (hookHeader)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 447 |
SELECT SQL_NO_CACHE disabled FROM ps_ed_prod_combi WHERE id_product = 1536 AND id_product_attribute = 1946 AND id_shop IN (1) LIMIT 1 |
0.095
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryHelper.php:73
/modules/estimateddelivery/classes/DeliveryHelper.php:57 (getCombinationDisabledStatus)
/modules/estimateddelivery/estimateddelivery.php:3655 (isDisabledCombination)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 325 |
SELECT SQL_NO_CACHE *
FROM `ps_trustedshops_channel` a
WHERE (a.`id_trustedshops_channel` = 9) LIMIT 1 |
0.094
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/modules/trustedshopseasyintegration/src/Service/ChannelService.php:716 (__construct)
/modules/trustedshopseasyintegration/src/Service/HookService.php:113 (getChannelFromIdShopIdLang)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:315 (getWidget)
/modules/trustedshopseasyintegration/src/Hook/HookLayout.php:147 (getWidgetModels)
:undefined (displayProductExtraContent)
/modules/trustedshopseasyintegration/vendor/totpsclasslib/src/Hook/AbstractHookDispatcher.php:108 (call_user_func)
/modules/trustedshopseasyintegration/src/Utils/ModuleTrait.php:183 (dispatch)
/modules/trustedshopseasyintegration/trustedshopseasyintegration.php:208 (handleExtensionsHook)
/classes/Hook.php:1077 (__call)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 444 |
SELECT SQL_NO_CACHE id_category
FROM `ps_ed_cat`
WHERE (excluded = 1) AND (id_category = 499) AND (id_shop IN (1)) LIMIT 1 |
0.094
ms
|
0 |
|
|
/modules/estimateddelivery/estimateddelivery.php:1413
/modules/estimateddelivery/estimateddelivery.php:3430 (getExcludedCat)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 446 |
SELECT SQL_NO_CACHE disabled FROM ps_ed_prod WHERE id_product = 1536 AND id_shop IN (1) LIMIT 1 |
0.094
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryHelper.php:68
/modules/estimateddelivery/classes/DeliveryHelper.php:46 (getProductDisabledStatus)
/modules/estimateddelivery/estimateddelivery.php:3648 (isDisabledProduct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 492 |
SELECT SQL_NO_CACHE location
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.094
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:806
/classes/Product.php:7869 (getLocation)
/classes/Product.php:751 (loadStockData)
/modules/giftcard/giftcard.php:1036 (__construct)
/classes/Hook.php:1077 (hookdisplayProductButtons)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 188 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1951 LIMIT 1 |
0.094
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 551 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1533 |
0.094
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/modules/iqitcrossselling/iqitcrossselling.php:352 (present)
/modules/iqitcrossselling/iqitcrossselling.php:213 (getOrderProducts)
/modules/iqitcrossselling/iqitcrossselling.php:244 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 266 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 2289 LIMIT 1 |
0.093
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 338 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1536 |
0.093
ms
|
2 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductPresenter.php:110 (__construct)
/controllers/front/ProductController.php:1245 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 364 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.093
ms
|
0 |
|
|
/classes/module/Module.php:2132
/modules/rcpgtagmanager/src/PSModule/ModuleDetector/AbstractModuleDetector.php:70 (isEnabled)
/modules/rcpgtagmanager/src/PSModule/ModuleDetector/AbstractModuleDetector.php:39 (detectByController)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:170 (getCheckoutModule)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:159 (getCheckoutModule)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:66 (getModuleData)
/modules/rcpgtagmanager/src/PSModule/Context/AbstractContext.php:54 (setContextData)
/modules/rcpgtagmanager/src/PSModule/ModuleServiceFactoryPS8.php:78 (__construct)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayHeader/AbstractDisplayHeader.php:57 (getContextService)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayHeader/AbstractDisplayHeader.php:39 (getConfiguration)
/modules/rcpgtagmanager/rcpgtagmanager.php:197 (exec)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 454 |
SELECT SQL_NO_CACHE picking_days AS add_picking_days FROM ps_ed_cat WHERE id_category = 499 AND id_shop IN (1) LIMIT 1 |
0.093
ms
|
0 |
|
|
/modules/estimateddelivery/classes/DeliveryProduct.php:823
/modules/estimateddelivery/classes/DeliveryProduct.php:906 (getCatAdditional)
/modules/estimateddelivery/classes/DeliveryProduct.php:732 (getCatPicking)
/modules/estimateddelivery/classes/DeliveryProduct.php:152 (getProductAdditionalDays)
/modules/estimateddelivery/estimateddelivery.php:3666 (__construct)
/modules/estimateddelivery/estimateddelivery.php:3452 (preProcessProducts)
/modules/estimateddelivery/estimateddelivery.php:3382 (showEstimatedDelivery)
/modules/estimateddelivery/estimateddelivery.php:5801 (generateEstimatedDelivery)
/classes/Hook.php:1077 (hookDisplayProductAdditionalInfo)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 318 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ph_simpleblog" LIMIT 1 |
0.092
ms
|
1 |
|
|
/src/Adapter/Module/ModuleDataProvider.php:257
/src/Adapter/Module/ModuleDataProvider.php:228 (getModuleIdByName)
/src/Core/Module/ModuleManager.php:329 (isInstalled)
/modules/ph_relatedposts/ph_relatedposts.php:41 (isInstalled)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 430 |
SELECT SQL_NO_CACHE location
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.092
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:806
/classes/Product.php:7869 (getLocation)
/classes/Product.php:751 (loadStockData)
/modules/omniversepricing/omniversepricing.php:1035 (__construct)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 278 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 2289 |
0.092
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 304 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1822 |
0.092
ms
|
1 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 56 |
SELECT SQL_NO_CACHE `name`
FROM `ps_manufacturer`
WHERE `id_manufacturer` = 2
AND `active` = 1 LIMIT 1 |
0.091
ms
|
1 |
|
|
/classes/Manufacturer.php:316
/classes/Product.php:734 (getNameById)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 367 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1
AND cl.`id_category` = 499 LIMIT 1 |
0.091
ms
|
0 |
|
|
/classes/Category.php:1378
/classes/Product.php:758 (getLinkRewrite)
/modules/fabfacebookpixel/fabfacebookpixel.php:544 (__construct)
/modules/fabfacebookpixel/fabfacebookpixel.php:539 (tryToGetAvailableIdProductAttribute)
/modules/fabfacebookpixel/fabfacebookpixel.php:502 (getIdProductAttributeByGroupOrRequestOrDefault)
/modules/fabfacebookpixel/fabfacebookpixel.php:641 (getSpecificEventData)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 50 |
SELECT SQL_NO_CACHE *
FROM `ps_group` a
LEFT JOIN `ps_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1 |
0.091
ms
|
1 |
|
|
/src/Adapter/EntityMapper.php:71
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Group.php:81 (__construct)
/classes/Group.php:397 (__construct)
/classes/Cart.php:249 (getCurrent)
/classes/Cart.php:222 (setTaxCalculationMethod)
/classes/controller/FrontController.php:467 (__construct)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 487 |
SELECT SQL_NO_CACHE `name`
FROM `ps_hook`
WHERE `id_hook` = 1039 LIMIT 1 |
0.091
ms
|
1 |
|
|
/classes/Hook.php:244
/classes/Hook.php:911 (getNameById)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 132 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 760 LIMIT 1 |
0.090
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 262 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 2282 |
0.090
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 404 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_languageselector" LIMIT 1 |
0.090
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 437 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 85 AND `id_shop` = 1 LIMIT 1 |
0.090
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:404 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:525 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 136 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 685 AND `id_group` = 1 LIMIT 1 |
0.089
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 184 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1948 |
0.089
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 17 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_lang_shop`
WHERE `id_lang` = 5
AND id_shop = 1 LIMIT 1 |
0.088
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/classes/Tools.php:642 (isAssociatedToShop)
/classes/Dispatcher.php:236 (switchLanguage)
/classes/Dispatcher.php:201 (__construct)
/index.php:39 (getInstance)
|
| 200 |
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1951 |
0.088
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Product.php:5912 (__construct)
/classes/Product.php:5875 (computeUnitPriceRatio)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 401 |
SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_content c WHERE c.active = 1 AND c.hook = 27 |
0.088
ms
|
6 |
|
|
/modules/iqitelementor/src/IqitElementorContent.php:127
/modules/iqitelementor/iqitelementor.php:717 (getByHook)
/modules/iqitelementor/iqitelementor.php:593 (getWidgetVariables)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:75 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:38 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 435 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1 |
0.088
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:88 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 579 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1 |
0.088
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechild/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php:84 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechild/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php:48 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313f12d74_59860912)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/classes/module/Module.php:2296 (fetch)
/modules/iqitwishlist/iqitwishlist.php:212 (fetch)
/classes/Hook.php:1088 (renderWidget)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 43 |
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1 |
0.087
ms
|
5 |
|
|
/classes/Language.php:883
/src/Adapter/Currency/CurrencyDataProvider.php:112 (getIdByLocale)
/src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php:102 (getCurrencyByIsoCodeAndLocale)
/src/Core/Data/Layer/AbstractDataLayer.php:91 (doRead)
/src/Core/Data/Layer/AbstractDataLayer.php:150 (read)
/src/Core/Data/Layer/AbstractDataLayer.php:95 (propagateRead)
/src/Core/Localization/Currency/CurrencyDataSource.php:67 (read)
/src/Core/Localization/Currency/CurrencyDataSource.php:109 (getLocalizedCurrencyData)
/src/Core/Localization/Currency/CurrencyDataSource.php:96 (formatCurrenciesData)
/src/Core/Localization/Currency/Repository.php:87 (getAllInstalledCurrenciesData)
/src/Core/Localization/Locale/Repository.php:207 (getAllInstalledCurrencies)
/src/Core/Localization/Locale/Repository.php:150 (getPriceSpecifications)
/classes/controller/Controller.php:209 (getLocale)
/classes/controller/FrontController.php:284 (init)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 84 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.087
ms
|
0 |
|
|
/classes/module/Module.php:2132
/modules/estimateddelivery/estimateddelivery.php:5411 (isEnabled)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 143 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.087
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 165 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1534 AND `id_group` = 1 LIMIT 1 |
0.087
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 238 |
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 5
AND cl.id_shop = 1
AND cl.`id_category` = 765 LIMIT 1 |
0.087
ms
|
1 |
|
|
/classes/Category.php:1378
/classes/Product.php:5658 (getLinkRewrite)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 418 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitfreedeliverycount" LIMIT 1 |
0.087
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php:41 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b70ab2_17867096)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php:32 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b48ca4_33419761)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php:28 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b433a1_28967025)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:144 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 92 |
SELECT SQL_NO_CACHE * FROM `ps_image_type` |
0.086
ms
|
9 |
|
|
/classes/ImageType.php:161
/classes/ImageType.php:202 (getByNameNType)
/modules/klaviyopsautomation/classes/BusinessLogicServices/ProductPayloadService.php:264 (getFormattedName)
/modules/klaviyopsautomation/classes/BusinessLogicServices/ProductPayloadService.php:248 (buildImageUrl)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:1043 (buildProductImageUrls)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:995 (addViewedProductData)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:983 (setupViewedProduct)
/modules/klaviyopsautomation/includes/KlaviyoPsModule.php:676 (setupProductEvents)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 439 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1 |
0.086
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/83/33/89/8333891e0ffe37ba6625e0aba7ec6b2a7a0e9010_2.file.product-additional-info.tpl.php:25 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31529c5c1_62629776)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:418 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:530 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:987 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 229 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 760 LIMIT 1 |
0.085
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 147 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1531 AND `id_group` = 1 LIMIT 1 |
0.085
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 186 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.085
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 202 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.085
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 211 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.085
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 67 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1536 AND id_shop=1 LIMIT 1 |
0.084
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 161 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.084
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 46 |
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1 |
0.083
ms
|
5 |
|
|
/classes/Language.php:883
/src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php:115 (getIdByLocale)
/src/Core/Data/Layer/AbstractDataLayer.php:91 (doRead)
/src/Core/Data/Layer/AbstractDataLayer.php:150 (read)
/src/Core/Data/Layer/AbstractDataLayer.php:95 (propagateRead)
/src/Core/Localization/Currency/CurrencyDataSource.php:67 (read)
/src/Core/Localization/Currency/CurrencyDataSource.php:109 (getLocalizedCurrencyData)
/src/Core/Localization/Currency/CurrencyDataSource.php:96 (formatCurrenciesData)
/src/Core/Localization/Currency/Repository.php:87 (getAllInstalledCurrenciesData)
/src/Core/Localization/Locale/Repository.php:207 (getAllInstalledCurrencies)
/src/Core/Localization/Locale/Repository.php:150 (getPriceSpecifications)
/classes/controller/Controller.php:209 (getLocale)
/classes/controller/FrontController.php:284 (init)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 170 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.083
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 176 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.083
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 225 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1617) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.083
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 357 |
SELECT SQL_NO_CACHE `need_identification_number`
FROM `ps_country`
WHERE `id_country` = 10 LIMIT 1 |
0.083
ms
|
1 |
|
|
/classes/Country.php:405
/classes/AddressFormat.php:634 (isNeedDniByCountryId)
/classes/AddressFormat.php:615 (getFormat)
/classes/AddressFormat.php:562 (getAddressCountryFormat)
/classes/AddressFormat.php:438 (getOrderedAddressFields)
/classes/controller/FrontController.php:1773 (generateAddress)
/classes/controller/FrontController.php:563 (getTemplateVarShop)
/classes/controller/FrontController.php:625 (assignGeneralPurposeVariables)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 207 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.082
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 44 |
SELECT SQL_NO_CACHE c.id_currency
FROM `ps_currency` c
WHERE (iso_code = 'EUR') LIMIT 1 |
0.081
ms
|
1 |
|
|
/classes/Currency.php:893
/src/Adapter/Currency/CurrencyDataProvider.php:92 (getIdByIsoCode)
/src/Adapter/Currency/CurrencyDataProvider.php:114 (getCurrencyByIsoCode)
/src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php:102 (getCurrencyByIsoCodeAndLocale)
/src/Core/Data/Layer/AbstractDataLayer.php:91 (doRead)
/src/Core/Data/Layer/AbstractDataLayer.php:150 (read)
/src/Core/Data/Layer/AbstractDataLayer.php:95 (propagateRead)
/src/Core/Localization/Currency/CurrencyDataSource.php:67 (read)
/src/Core/Localization/Currency/CurrencyDataSource.php:109 (getLocalizedCurrencyData)
/src/Core/Localization/Currency/CurrencyDataSource.php:96 (formatCurrenciesData)
/src/Core/Localization/Currency/Repository.php:87 (getAllInstalledCurrenciesData)
/src/Core/Localization/Locale/Repository.php:207 (getAllInstalledCurrencies)
/src/Core/Localization/Locale/Repository.php:150 (getPriceSpecifications)
/classes/controller/Controller.php:209 (getLocale)
/classes/controller/FrontController.php:284 (init)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 157 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.081
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 220 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 746 LIMIT 1 |
0.081
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 192 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1539) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.081
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 270 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1825) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.081
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 234 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1821) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 244 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1822) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 155 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1533 AND id_shop=1 LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 205 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1540 AND id_shop=1 LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 223 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1617 AND id_shop=1 LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 589 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`id_category` = 760 LIMIT 1 |
0.079
ms
|
1 |
|
|
/classes/Category.php:1585
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 242 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1822 AND id_shop=1 LIMIT 1 |
0.078
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 48 |
SELECT SQL_NO_CACHE *
FROM `ps_currency_lang`
WHERE `id_currency` = 1 |
0.078
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Currency.php:246 (__construct)
/classes/Currency.php:1089 (__construct)
/classes/Tools.php:690 (getCurrencyInstance)
/classes/controller/FrontController.php:368 (setCurrency)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 72 |
SELECT SQL_NO_CACHE out_of_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.078
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:778
/classes/Product.php:7867 (outOfStock)
/classes/Product.php:751 (loadStockData)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 254 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1824) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.078
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5802 (getQuantity)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 51 |
SELECT SQL_NO_CACHE *
FROM `ps_group_lang`
WHERE `id_group` = 1 |
0.077
ms
|
5 |
|
|
/src/Adapter/EntityMapper.php:79
/classes/ObjectModel.php:283 (load)
/tools/profiling/ObjectModel.php:32 (__construct)
/classes/Group.php:81 (__construct)
/classes/Group.php:397 (__construct)
/classes/Cart.php:249 (getCurrent)
/classes/Cart.php:222 (setTaxCalculationMethod)
/classes/controller/FrontController.php:467 (__construct)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 74 |
SELECT SQL_NO_CACHE location
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:806
/classes/Product.php:7869 (getLocation)
/classes/Product.php:751 (loadStockData)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 174 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1537 AND id_shop=1 LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 214 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1543 AND id_shop=1 LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 248 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 760 LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 264 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 765 LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 321 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ph_relatedposts" LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 385 |
SELECT SQL_NO_CACHE `value_type`
FROM `ps_gift_card`
WHERE id_product = 1536 LIMIT 1 |
0.077
ms
|
4 |
|
|
/modules/giftcard/models/Gift.php:176
/modules/giftcard/giftcard.php:910 (getGiftCardType)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 410 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitwishlist" LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:114 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 543 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1 |
0.077
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:757 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:1054 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 54 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 135 AND `id_shop` = 1 LIMIT 1 |
0.076
ms
|
1 |
|
|
/classes/module/Module.php:2132
/override/classes/CartRule.php:36 (isEnabled)
/classes/controller/FrontController.php:492 (autoRemoveFromCart)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 68 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1536 AND `id_group` = 1 LIMIT 1 |
0.076
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 232 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1821 AND id_shop=1 LIMIT 1 |
0.076
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 252 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1824 AND id_shop=1 LIMIT 1 |
0.076
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 268 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1825 AND id_shop=1 LIMIT 1 |
0.076
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 190 |
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1539 AND id_shop=1 LIMIT 1 |
0.076
ms
|
1 |
|
|
/classes/Product.php:6876
/classes/Product.php:3925 (getIdTaxRulesGroupByIdProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 10 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1 |
0.075
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/config/config.inc.php:216 (isAssociatedToShop)
/index.php:38 (require)
|
| 429 |
SELECT SQL_NO_CACHE depends_on_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.075
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:753
/classes/Product.php:7868 (dependsOnStock)
/classes/Product.php:751 (loadStockData)
/modules/omniversepricing/omniversepricing.php:1035 (__construct)
/modules/omniversepricing/omniversepricing.php:982 (omniversepricing_init)
/classes/Hook.php:1077 (hookDisplayProductPriceBlock)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/07/03/78/070378b47e41a59d755c355ac35b6928a38d4ae2_2.file.product-prices.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3152564a9_12917847)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:341 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:376 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:965 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 87 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.073
ms
|
0 |
|
|
/classes/module/Module.php:2132
/modules/codfee/codfee.php:331 (isEnabled)
/classes/Hook.php:1077 (hookActionFrontControllerSetMedia)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:1004 (exec)
/tools/profiling/Controller.php:48 (setMedia)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 306 |
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1824 |
0.073
ms
|
7 |
|
|
/classes/Product.php:2902
/src/Adapter/Image/ImageRetriever.php:90 (getCombinationImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:688 (getAllProductImages)
/src/Adapter/Presenter/Product/ProductLazyArray.php:127 (fillImages)
/src/Adapter/Presenter/Product/ProductListingPresenter.php:57 (__construct)
/controllers/front/ProductController.php:411 (present)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 329 |
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1946 LIMIT 1 |
0.073
ms
|
1 |
|
|
/classes/Combination.php:564
/classes/Product.php:5678 (getPrice)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 53 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "quantitydiscountpro" LIMIT 1 |
0.072
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/override/classes/CartRule.php:36 (isEnabled)
/classes/controller/FrontController.php:492 (autoRemoveFromCart)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 331 |
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 1946) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.072
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:453
/classes/Product.php:4349 (getQuantityAvailableByProduct)
/classes/Product.php:5814 (getQuantity)
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 372 |
SELECT SQL_NO_CACHE `id_default_group`
FROM `ps_customer`
WHERE `id_customer` = 0 LIMIT 1 |
0.072
ms
|
0 |
|
|
/classes/Customer.php:1154
/modules/fabfacebookpixel/libs/FFPUtils.php:332 (getDefaultGroupId)
/modules/fabfacebookpixel/fabfacebookpixel.php:675 (getDefaultCustomerGroup)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 425 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1 |
0.072
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/8f/d6/9a/8fd69a4f53cf2f3e384b1d901d7d353982efa142_2.file.product-thumbnails.tpl.php:49 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/8f/d6/9a/8fd69a4f53cf2f3e384b1d901d7d353982efa142_2.file.product-thumbnails.tpl.php:29 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3151f02e3_54237143)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/0c/26/39/0c2639e8d6890977b6d7e1fa2271d68dea188e17_2.file.product-cover-thumbnails.tpl.php:37 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3151e0d76_82435627)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:163 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:202 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:248 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:955 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:135 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:186 (process)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:120 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 400 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 75 AND `id_shop` = 1 LIMIT 1 |
0.071
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:75 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:38 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 411 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1 |
0.071
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:114 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 414 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1 |
0.070
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:68 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 593 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 5 AND cl.id_shop = 1 ) WHERE c.`id_category` = 746 LIMIT 1 |
0.070
ms
|
1 |
|
|
/classes/Category.php:1585
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 73 |
SELECT SQL_NO_CACHE depends_on_stock
FROM `ps_stock_available`
WHERE (id_product = 1536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.069
ms
|
1 |
|
|
/classes/stock/StockAvailable.php:753
/classes/Product.php:7868 (dependsOnStock)
/classes/Product.php:751 (loadStockData)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 49 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1 |
0.068
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/classes/Tools.php:699 (isAssociatedToShop)
/classes/controller/FrontController.php:368 (setCurrency)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 419 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1 |
0.068
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php:41 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b70ab2_17867096)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php:32 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b48ca4_33419761)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php:28 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313b433a1_28967025)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/28/67/02/286702c4caf015ef5067711a36fab386e8022fb5_2.file.header-4.tpl.php:144 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c313488270_16240365)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:155 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:50 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 319 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ph_simpleblog" LIMIT 1 |
0.068
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2131 (getModuleIdByName)
/modules/ph_relatedposts/ph_relatedposts.php:41 (isEnabled)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 380 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.068
ms
|
0 |
|
|
/classes/module/Module.php:2132
/modules/codfee/codfee.php:347 (isEnabled)
/modules/codfee/codfee.php:339 (hookHeader)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 405 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1 |
0.068
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:106 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/48/fd/6e/48fd6ebac4ea4cea5d47a525e9a6c7eea79ebf50_2.file.header.tpl.php:44 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c31341dab0_92121639)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:302 (_subTemplateRender)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:87 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 585 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1 |
0.068
ms
|
1 |
|
|
/classes/Category.php:1591
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:216 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 215 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1543 AND `id_group` = 1 LIMIT 1 |
0.067
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 383 |
SELECT SQL_NO_CACHE `id_product`
FROM `ps_product` WHERE id_product = 1536 LIMIT 1 |
0.067
ms
|
1 |
|
|
/modules/giftcard/models/Gift.php:123
/modules/giftcard/giftcard.php:854 (isExists)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 600 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1 |
0.067
ms
|
1 |
|
|
/classes/Category.php:1591
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 52 |
SELECT SQL_NO_CACHE id_shop
FROM `ps_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1 |
0.066
ms
|
1 |
|
|
/classes/ObjectModel.php:1729
/classes/Group.php:400 (isAssociatedToShop)
/classes/Cart.php:249 (getCurrent)
/classes/Cart.php:222 (setTaxCalculationMethod)
/classes/controller/FrontController.php:467 (__construct)
/controllers/front/ProductController.php:124 (init)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 239 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 765 LIMIT 1 |
0.066
ms
|
1 |
|
|
/classes/Product.php:5659
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 335 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "giftcard" LIMIT 1 |
0.064
ms
|
1 |
|
|
/classes/module/Module.php:2659
/classes/module/Module.php:2107 (getModuleIdByName)
/override/controllers/front/ProductController.php:29 (isInstalled)
/controllers/front/ProductController.php:1215 (addProductCustomizationData)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 206 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1540 AND `id_group` = 1 LIMIT 1 |
0.063
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 69 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_group`
WHERE `id_group` = 1 LIMIT 1 |
0.063
ms
|
1 |
|
|
/classes/Group.php:154
/classes/Product.php:3994 (getReductionByIdGroup)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:748 (getPriceStatic)
/controllers/front/ProductController.php:146 (__construct)
/tools/profiling/Controller.php:41 (init)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 320 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 89 AND `id_shop` = 1 LIMIT 1 |
0.062
ms
|
1 |
|
|
/classes/module/Module.php:2132
/modules/ph_relatedposts/ph_relatedposts.php:41 (isEnabled)
:undefined (__construct)
/src/Core/Foundation/IoC/Container.php:123 (newInstance)
/src/Core/Foundation/IoC/Container.php:153 (makeInstanceFromClassName)
/src/Core/Foundation/IoC/Container.php:166 (doMake)
/src/Adapter/ServiceLocator.php:70 (make)
/classes/module/Module.php:1258 (get)
/tools/profiling/Module.php:35 (coreLoadModule)
/classes/module/Module.php:1237 (coreLoadModule)
/classes/Hook.php:966 (getInstanceByName)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 156 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1533 AND `id_group` = 1 LIMIT 1 |
0.061
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 328 |
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 5 AND id_category = 499 LIMIT 1 |
0.061
ms
|
1 |
|
|
/classes/Product.php:5659
/controllers/front/ProductController.php:1213 (getProductProperties)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 384 |
SELECT SQL_NO_CACHE `id_image`
FROM `ps_image` WHERE cover = 1
AND id_product = 1536 LIMIT 1 |
0.060
ms
|
1 |
|
|
/modules/giftcard/models/Gift.php:353
/modules/giftcard/giftcard.php:856 (getId_image)
/classes/Hook.php:1077 (hookDisplayHeader)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/classes/controller/FrontController.php:633 (exec)
/controllers/front/ProductController.php:465 (initContent)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 191 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1539 AND `id_group` = 1 LIMIT 1 |
0.060
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 269 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1825 AND `id_group` = 1 LIMIT 1 |
0.060
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 175 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1537 AND `id_group` = 1 LIMIT 1 |
0.059
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 224 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1617 AND `id_group` = 1 LIMIT 1 |
0.059
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 233 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1821 AND `id_group` = 1 LIMIT 1 |
0.059
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 243 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1822 AND `id_group` = 1 LIMIT 1 |
0.059
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 253 |
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1824 AND `id_group` = 1 LIMIT 1 |
0.059
ms
|
0 |
|
|
/classes/GroupReduction.php:156
/classes/Product.php:3990 (getValueForProduct)
/classes/Product.php:3717 (priceCalculation)
/classes/Product.php:5692 (getPriceStatic)
/classes/Product.php:5990 (getProductProperties)
/classes/Product.php:4716 (getProductsProperties)
/controllers/front/ProductController.php:405 (getAccessories)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 322 |
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 91 AND `id_shop` = 1 LIMIT 1 |
0.052
ms
|
1 |
|
|
/classes/module/Module.php:2132
/classes/Hook.php:1083 (isEnabled)
/tools/profiling/Hook.php:64 (coreRenderWidget)
/classes/Hook.php:1019 (coreRenderWidget)
/src/Adapter/HookManager.php:81 (exec)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:70 (exec)
/src/Core/Product/ProductExtraContentFinder.php:55 (find)
/src/PrestaShopBundle/Service/Hook/HookFinder.php:102 (find)
/controllers/front/ProductController.php:1209 (present)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 590 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1 |
0.051
ms
|
1 |
|
|
/classes/Category.php:1591
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 336 |
SELECT SQL_NO_CACHE `id_product`
FROM `ps_product` WHERE id_product = 1536 LIMIT 1 |
0.049
ms
|
1 |
|
|
/modules/giftcard/models/Gift.php:123
/override/controllers/front/ProductController.php:31 (isExists)
/controllers/front/ProductController.php:1215 (addProductCustomizationData)
/controllers/front/ProductController.php:421 (getTemplateVarProduct)
/override/controllers/front/ProductController.php:7 (initContent)
/tools/profiling/Controller.php:60 (initContent)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|
| 594 |
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1 |
0.049
ms
|
1 |
|
|
/classes/Category.php:1591
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:56 (getParentsCategories)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Category/AbstractCategoryModelBuilder.php:42 (getCategoryPath)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/ModelBuilder/Product/AbstractProductModelBuilder.php:63 (initModel)
/modules/rcpgtagmanager/src/PSModule/DataModelHandler/DataModelHandler.php:108 (setDetailData)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:226 (buildDetailProductModelList)
/modules/rcpgtagmanager/src/PSModule/Hook/DisplayBeforeBodyClosingTag/AbstractDisplayBeforeBodyClosingTag.php:72 (processPage)
/modules/rcpgtagmanager/rcpgtagmanager.php:229 (exec)
/classes/Hook.php:1077 (hookDisplayBeforeBodyClosingTag)
/tools/profiling/Hook.php:35 (coreCallHook)
/classes/Hook.php:418 (coreCallHook)
/classes/Hook.php:983 (callHookOn)
/config/smarty.config.inc.php:201 (exec)
/classes/Smarty/SmartyLazyRegister.php:81 (smartyHook)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:574 (__call)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:248 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:184 (callBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:156 (process)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/75/9c/8d/759c8dc69d0f7a64eb9fdc4cc54ea843d7384550_2.file.layout-both-columns.tpl.php:167 (instanceBlock)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133bd3a3_51790492)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/da/8b/b5/da8bb58eaba9d2238d973750bda79685de371986_2.file.layout-full-width.tpl.php:50 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c3133a8005_10024983)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:386 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php:116 (_subTemplateRender)
/var/cache/prod/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7c/90/cd/7c90cdd421e0ac936291f9b34cbc07b52cc20221_2.file.product.tpl.php:65 (endChild)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php:123 (content_6900c314cb1b02_56091777)
/vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php:114 (getRenderedTemplateCode)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php:217 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:238 (render)
/vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php:116 (_execute)
/override/classes/controller/FrontController.php:22 (fetch)
/classes/controller/FrontController.php:753 (smartyOutputContent)
/tools/profiling/Controller.php:106 (display)
/tools/profiling/Controller.php:83 (displayProfiling)
/classes/Dispatcher.php:510 (run)
/index.php:39 (dispatch)
|